Lus10039443 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14920 97 / 1e-24 Gibberellin-regulated family protein (.1.2)
AT1G75750 67 / 8e-15 GASA1 GAST1 protein homolog 1 (.1.2)
AT2G18420 66 / 9e-15 Gibberellin-regulated family protein (.1)
AT4G09600 60 / 2e-12 GASA3 GAST1 protein homolog 3 (.1)
AT1G22690 61 / 3e-12 Gibberellin-regulated family protein (.1.2.3)
AT5G15230 48 / 9e-08 GASA4 GAST1 protein homolog 4 (.1.2)
AT1G74670 48 / 1e-07 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT2G14900 47 / 4e-07 Gibberellin-regulated family protein (.1)
AT5G59845 43 / 6e-06 Gibberellin-regulated family protein (.1)
AT1G10588 42 / 9e-06 Gibberellin-regulated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017212 69 / 9e-16 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10009421 70 / 4e-15 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10034524 66 / 1e-14 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10033145 64 / 1e-13 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10014262 64 / 1e-13 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10025962 64 / 2e-13 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10021098 57 / 4e-11 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1)
Lus10004048 55 / 3e-10 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10024338 54 / 7e-10 ND 78 / 3e-20
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G350600 109 / 5e-30 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
Potri.012G076700 94 / 2e-25 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.015G071500 93 / 6e-25 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.019G083900 77 / 1e-18 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.005G239000 71 / 3e-16 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.002G022500 67 / 5e-15 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.005G239100 66 / 2e-14 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022600 66 / 2e-14 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022700 63 / 2e-13 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.013G113400 59 / 7e-12 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Lus10039443 pacid=23175454 polypeptide=Lus10039443 locus=Lus10039443.g ID=Lus10039443.BGIv1.0 annot-version=v1.0
ATGGCATCCAAAGCCTTCTTCTTTCTACTTGCTACTGCTGTTCTAGCTCTTTCTTCTCATGCTGCTGCTGATCAAGATAATCACTTCTTCGATGAGGCTG
TTACCACTAAATATGTGAAATCTCCACCACCTCAACTGGCACCGGTAGTGCCGCCGGTGAAGCCACTTCCAAGTCCCTCTCCTCCACCGTCACCGCCGTA
CAGCAAGCCACCACCAGCAGCTCCAACTCCACACTACCCACCACCGGTCGCCAAACCGCCTACTCCTGCCCCTGCCCCTGCCCCACTTCCAACGCCACCA
CCCCCGATCAGGTCCATTAAAGACTGCGTTCCATTGTGCAGCGAGAGGTGCAAGCTACACTCGAGGCAAAATGTGTGCAACAGAGCATGTATAACTTGCT
GTGGTAGGTGCAAATGCGTGCCTCCTGGAACTTATGGGAATAGGGAAAAGTGCGGGACTTGCTACACTGGAATGACCACCCGCTTCAATAAACCCAAGTG
CCCTTAG
AA sequence
>Lus10039443 pacid=23175454 polypeptide=Lus10039443 locus=Lus10039443.g ID=Lus10039443.BGIv1.0 annot-version=v1.0
MASKAFFFLLATAVLALSSHAAADQDNHFFDEAVTTKYVKSPPPQLAPVVPPVKPLPSPSPPPSPPYSKPPPAAPTPHYPPPVAKPPTPAPAPAPLPTPP
PPIRSIKDCVPLCSERCKLHSRQNVCNRACITCCGRCKCVPPGTYGNREKCGTCYTGMTTRFNKPKCP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14920 Gibberellin-regulated family p... Lus10039443 0 1
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10021157 1.0 0.9877
AT3G27360 Histone superfamily protein (.... Lus10013948 2.0 0.9861
AT2G20515 unknown protein Lus10022928 2.8 0.9705
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10005892 3.5 0.9814
AT3G53730 Histone superfamily protein (.... Lus10038481 5.7 0.9760
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10041347 5.9 0.9753
AT4G11080 3xHMG-box1 3xHigh Mobility Group-box1, HM... Lus10032379 6.3 0.9661
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10040853 6.5 0.9717
AT3G12210 DNA binding (.1.2) Lus10007717 8.5 0.9483
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10037371 9.2 0.9753

Lus10039443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.