Plant FIBer expression Database

Lus10039449 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04700 210 / 1e-70 ferredoxin thioredoxin reductase catalytic beta chain family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039468
[exp]
293 / 2e-103 AT2G04700 217 / 1e-73 ferredoxin thioredoxin reductase catalytic beta chain family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G350900
[exp]
210 / 8e-71 AT2G04700 231 / 1e-79 ferredoxin thioredoxin reductase catalytic beta chain family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02943 FeThRed_B Ferredoxin thioredoxin reductase catalytic beta chain
Representative CDS sequence
>Lus10039449 pacid=23175508 polypeptide=Lus10039449 locus=Lus10039449.g ID=Lus10039449.BGIv1.0 annot-version=v1.0
ATGACTCTTCAAGCCACTTCTTGTAGCTTCGCCGGTGTCTCTTCCTTCCCCTCTCCGCCTTCCGCAGCTTCCCGTCCTCACCGCCACCCTGTCCGTACCA
CCGTTGTTCGTTCTCAAGCTGTTGATCCCAAGGACAAGTCTGTTGAAATAATGAGGAAATTCTCGGAGCAGTACGCTCGTAGGTCCGGGACTTACTTCTG
CTCCGATAAGGGAGTCACTTCCGTTGTTATTAAGGGTCTGGCGGAGCATAAAGATTCATTGGGTGCACCTCTTTGCCCTTGTAGGCATTATGATGACAAA
GCTGCGGAAGCAGGGCAGGGCTTTTGGAACTGTCCTTGTGTCCCCATGAGAGAGAGGAAGGAGTGTCATTGCATGCTTTTTCTCACCCCAGAAAATGATT
TTTCCGGCAAAGATCAGGTAATTCTGGCTCCTTCCATTGATTATATACCGGGGCCTTCTTGTAAAGTGAACAGACTCTACCCTGGTTCATTCATAAACGC
ATGA
AA sequence
>Lus10039449 pacid=23175508 polypeptide=Lus10039449 locus=Lus10039449.g ID=Lus10039449.BGIv1.0 annot-version=v1.0
MTLQATSCSFAGVSSFPSPPSAASRPHRHPVRTTVVRSQAVDPKDKSVEIMRKFSEQYARRSGTYFCSDKGVTSVVIKGLAEHKDSLGAPLCPCRHYDDK
AAEAGQGFWNCPCVPMRERKECHCMLFLTPENDFSGKDQVILAPSIDYIPGPSCKVNRLYPGSFINA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04700 ferredoxin thioredoxin reducta... Lus10039449
[exp]
0 1
AT2G04700 ferredoxin thioredoxin reducta... Lus10039468
[exp]
1.0 0.9773
AT1G51110 Plastid-lipid associated prote... Lus10010444
[exp]
1.4 0.9702
AT1G07280 Tetratricopeptide repeat (TPR)... Lus10001206
[exp]
4.2 0.9426
AT4G12830 alpha/beta-Hydrolases superfam... Lus10008747
[exp]
5.5 0.9628
AT4G31530 NAD(P)-binding Rossmann-fold s... Lus10009715
[exp]
5.5 0.9426
AT3G55800 SBPASE sedoheptulose-bisphosphatase (... Lus10040228
[exp]
6.3 0.9540
AT5G22620 phosphoglycerate/bisphosphogly... Lus10015442
[exp]
6.5 0.9273
AT3G48420 Haloacid dehalogenase-like hyd... Lus10013663
[exp]
7.2 0.9552
AT4G22890 PGR5-LIKEA, PGR... PGR5-LIKE A (.1.2.3.4.5) Lus10006710
[exp]
8.8 0.9450
AT3G55800 SBPASE sedoheptulose-bisphosphatase (... Lus10028261
[exp]
9.5 0.9512

Lus10039449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.