Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14950 59 / 3e-12 GMII, ATGMII golgi alpha-mannosidase II (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015337 [exp] 96 / 3e-25 AT5G14950 1506 / 0.0 golgi alpha-mannosidase II (.1) Lus10014507 [exp] 79 / 3e-19 AT5G14950 1552 / 0.0 golgi alpha-mannosidase II (.1) Lus10032179 [exp] 79 / 4e-19 AT5G14950 1265 / 0.0 golgi alpha-mannosidase II (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G073900 [exp] 71 / 1e-16 AT5G14950 1672 / 0.0 golgi alpha-mannosidase II (.1) Potri.001G350400 [exp] 71 / 2e-16 AT5G14950 1678 / 0.0 golgi alpha-mannosidase II (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039456 pacid=23175640 polypeptide=Lus10039456 locus=Lus10039456.g ID=Lus10039456.BGIv1.0 annot-version=v1.0 ATGCCAGAAGCAACGTCTCTGAATCTTCTTCACGATGACATGGACCTACTGGGTTACCATGAGAAGGCGGGAGATGTATCTGAGGATGGTCGTGTTTCCA TATCTCCGATGGAGATTCAAGCATACAAGTTAGAGTTGCGGCCCAACCAGTAG
AA sequence Show only first row Show all	>Lus10039456 pacid=23175640 polypeptide=Lus10039456 locus=Lus10039456.g ID=Lus10039456.BGIv1.0 annot-version=v1.0 MPEATSLNLLHDDMDLLGYHEKAGDVSEDGRVSISPMEIQAYKLELRPNQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14950		GMII, ATGMII	golgi alpha-mannosidase II (.1...		Lus10039456 [exp]	0	1
AT2G28060			5'-AMP-activated protein kinas...		Lus10008427 [exp]	6.0	0.8946
AT5G26610			D111/G-patch domain-containing...		Lus10031446 [exp]	6.0	0.9103
AT5G11330			FAD/NAD(P)-binding oxidoreduct...		Lus10013121 [exp]	8.4	0.8934
AT1G07570		APK1A	Protein kinase superfamily pro...		Lus10000954 [exp]	10.2	0.8920
AT3G18215			Protein of unknown function, D...		Lus10009640 [exp]	10.5	0.8843
AT4G27120			unknown protein		Lus10011161 [exp]	12.5	0.8998
AT1G54730			Major facilitator superfamily ...		Lus10029966 [exp]	13.4	0.8960
AT2G17787			unknown protein		Lus10017274 [exp]	19.1	0.8828
AT3G60300			RWD domain-containing protein ...		Lus10009773 [exp]	20.5	0.8641
AT3G49640			Aldolase-type TIM barrel famil...		Lus10003486 [exp]	21.2	0.8963

Compare expression of checked genes

Lus10039456 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.