Lus10039471 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40150 278 / 1e-94 Peroxidase superfamily protein (.1)
AT3G28200 255 / 7e-86 Peroxidase superfamily protein (.1)
AT5G47000 209 / 2e-67 Peroxidase superfamily protein (.1)
AT4G17690 196 / 1e-62 Peroxidase superfamily protein (.1)
AT1G24110 194 / 2e-61 Peroxidase superfamily protein (.1)
AT4G37520 145 / 8e-43 Peroxidase superfamily protein (.1.2)
AT2G18980 142 / 1e-41 Peroxidase superfamily protein (.1)
AT4G37530 141 / 3e-41 Peroxidase superfamily protein (.1.2)
AT5G14130 140 / 6e-41 Peroxidase superfamily protein (.1)
AT2G34060 139 / 2e-40 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039445 351 / 1e-123 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10014517 313 / 2e-110 AT5G40150 280 / 2e-95 Peroxidase superfamily protein (.1)
Lus10032170 311 / 9e-110 AT5G40150 280 / 2e-95 Peroxidase superfamily protein (.1)
Lus10029201 227 / 6e-76 AT1G24110 288 / 6e-98 Peroxidase superfamily protein (.1)
Lus10010716 228 / 5e-75 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10004234 211 / 5e-68 AT1G24110 391 / 1e-136 Peroxidase superfamily protein (.1)
Lus10042144 209 / 2e-67 AT1G24110 390 / 2e-136 Peroxidase superfamily protein (.1)
Lus10013955 152 / 2e-44 AT2G34060 451 / 1e-158 Peroxidase superfamily protein (.1)
Lus10032035 148 / 1e-43 AT5G67400 394 / 3e-138 root hair specific 19 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G351000 268 / 1e-90 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.010G036100 228 / 4e-75 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.012G076500 228 / 9e-75 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1)
Potri.007G074700 179 / 1e-55 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
Potri.004G052100 151 / 1e-44 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
Potri.017G064100 149 / 3e-44 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.007G053400 147 / 2e-43 AT5G67400 471 / 4e-168 root hair specific 19 (.1)
Potri.001G329200 146 / 5e-43 AT4G37530 392 / 4e-137 Peroxidase superfamily protein (.1.2)
Potri.018G089900 139 / 3e-40 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.008G103200 135 / 9e-39 AT4G16270 438 / 1e-154 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10039471 pacid=23175647 polypeptide=Lus10039471 locus=Lus10039471.g ID=Lus10039471.BGIv1.0 annot-version=v1.0
ATGGTCGGCGGCCCTTACTACAACGTCCTACTCGGCCGCCTCGACTACCGCATCTCCAAGTCTTCCTTCATCCCCGGAAACCTCCCTTTGCCGTCGATGT
CCACCTCGCAAATGATCGGAATGTTCGCTGCCAGGGGATTCTCTGTCCAGGAGATGGTGGCGCTTAGCGGGGCTCACACCATTGGGTTTTCTCACTGTAA
AGAGTTCAGCGGGCTGCTCTACAACGGTAGCTCAAGCGGATACAATCCGAGATTTGCGCAGGCGCTTCGGAAGGCGTGCACCAATTCAAGGAAGGACCCG
TCGGTTTCGGTGTTCAACGACATAATGACACCCAACAAATTCGACAATGTGTACTACCAGAACTTGCCCAAGGGGCTGGGTTTGCTGGCGTCGGACCACG
CCCTGGTCAAAGACGACAGGACACGGCCCTTTGTGGAGATGTACGCCAGGGATCAGAACAAGTTCTTCCATGATTTCGCCAATGCGATGCAGAAGCTGAG
CGTTTATGGGATCAAGACTGGGAGGAGAGGCGAAATTAGGCACAGGTGTGATGCTATCAACTGA
AA sequence
>Lus10039471 pacid=23175647 polypeptide=Lus10039471 locus=Lus10039471.g ID=Lus10039471.BGIv1.0 annot-version=v1.0
MVGGPYYNVLLGRLDYRISKSSFIPGNLPLPSMSTSQMIGMFAARGFSVQEMVALSGAHTIGFSHCKEFSGLLYNGSSSGYNPRFAQALRKACTNSRKDP
SVSVFNDIMTPNKFDNVYYQNLPKGLGLLASDHALVKDDRTRPFVEMYARDQNKFFHDFANAMQKLSVYGIKTGRRGEIRHRCDAIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40150 Peroxidase superfamily protein... Lus10039471 0 1
AT1G02000 GAE2 UDP-D-glucuronate 4-epimerase ... Lus10027195 1.0 0.9181
Lus10042355 2.8 0.8963
AT4G37250 Leucine-rich repeat protein ki... Lus10030333 3.0 0.8533
AT4G08150 HD BP1, KNAT1 BREVIPEDICELLUS 1, BREVIPEDICE... Lus10028244 3.5 0.8645
Lus10026314 3.5 0.8804
AT1G10020 Protein of unknown function (D... Lus10032807 4.7 0.8292
AT1G68330 unknown protein Lus10034341 6.7 0.8386
Lus10024338 7.3 0.8359
AT1G01540 Protein kinase superfamily pro... Lus10007919 8.1 0.8433
AT4G35320 unknown protein Lus10022985 8.4 0.8408

Lus10039471 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.