Lus10039488 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43700 247 / 3e-84 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
AT1G04240 247 / 3e-84 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
AT3G23030 207 / 1e-68 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1)
AT4G14560 201 / 3e-66 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1)
AT3G04730 180 / 2e-57 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1)
AT4G14550 171 / 1e-53 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
AT4G29080 169 / 5e-52 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1)
AT3G23050 164 / 1e-50 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2)
AT3G15540 160 / 6e-50 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1)
AT1G04250 159 / 3e-49 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039413 379 / 3e-136 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
Lus10014729 236 / 2e-79 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
Lus10002723 223 / 1e-74 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Lus10024853 217 / 8e-72 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
Lus10018764 214 / 8e-71 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Lus10028222 192 / 4e-61 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2)
Lus10042929 180 / 1e-55 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2)
Lus10039414 168 / 3e-52 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
Lus10011583 167 / 2e-51 AT5G65670 333 / 2e-114 indole-3-acetic acid inducible 9 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G078400 261 / 7e-90 AT5G43700 248 / 9e-85 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.008G161100 262 / 8e-90 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.005G218200 253 / 1e-86 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.013G041300 253 / 1e-86 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.005G053800 251 / 9e-86 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.002G045000 245 / 2e-83 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.008G161200 181 / 1e-57 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
Potri.013G041400 181 / 3e-57 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1)
Potri.002G044900 173 / 1e-54 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
Potri.005G053900 173 / 2e-54 AT3G04730 317 / 3e-110 indoleacetic acid-induced protein 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF02309 AUX_IAA AUX/IAA family
Representative CDS sequence
>Lus10039488 pacid=23175631 polypeptide=Lus10039488 locus=Lus10039488.g ID=Lus10039488.BGIv1.0 annot-version=v1.0
ATGGAAGGTGCTACATATGAAAGTGACTTGAACTTCGAGGCAACCGAGCTCAGGCTTGGACTGCCTGGCTCAGGAGAAGAAGAAACTGCTGTTAAAAGCA
ACAACAAACGACCTATGCCTGCAGAGACCAACGAAGAAATCGAAGCCAAGGGAAGATCTGGAGATCATGTTCAAGCTGCCCCTGCTGCTAAGGCACAGAT
TGTGGGCTGGCCACCAATCCGATCCTACAGGAAGAATAGCTTGCAGCCAAAGAAAAGTACTGAAGCTGCTGATGGTGCTAGCGGGATGTACGTGAAAGTT
AGCATGGATGGAGCACCATATCTCAGGAAGATTGACCTCAAGGTCTATAGAGGCTACCCTGAACTCCTAATGGCTTTGGAGACCATGTTTAAGTTTGCTG
CTGGTGTCTACTCTGAGAGAGAAGGTTATAAAGGGTCCGAGCACGTACCTACTTATGAAGACAAAGATGGTGACTGGATGCTCGTTGGAGATGTTCCTTG
GGACATGTTCATGTCATCCTGTAAGAGGTTGAGAATCATGAAAGGATCAGAAGCAAGAGGATTGGGATGTGGTGTATGA
AA sequence
>Lus10039488 pacid=23175631 polypeptide=Lus10039488 locus=Lus10039488.g ID=Lus10039488.BGIv1.0 annot-version=v1.0
MEGATYESDLNFEATELRLGLPGSGEEETAVKSNNKRPMPAETNEEIEAKGRSGDHVQAAPAAKAQIVGWPPIRSYRKNSLQPKKSTEAADGASGMYVKV
SMDGAPYLRKIDLKVYRGYPELLMALETMFKFAAGVYSEREGYKGSEHVPTYEDKDGDWMLVGDVPWDMFMSSCKRLRIMKGSEARGLGCGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G43700 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible... Lus10039488 0 1
AT1G04240 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-ac... Lus10039413 2.6 0.7821
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10040731 8.9 0.7294
AT5G40960 Protein of unknown function (D... Lus10035200 10.2 0.7111
AT2G22140 ATEME1B essential meiotic endonuclease... Lus10005803 13.5 0.6975
Lus10028987 15.6 0.6821
AT5G49800 Polyketide cyclase/dehydrase a... Lus10026274 25.6 0.6881
AT5G03960 IQD12 IQ-domain 12 (.1) Lus10042027 28.9 0.6499
AT1G53440 Leucine-rich repeat transmembr... Lus10041937 32.6 0.7033
AT5G21280 hydroxyproline-rich glycoprote... Lus10038083 33.2 0.6218
AT3G61880 CYP78A9 cytochrome p450 78a9 (.1.2) Lus10017334 46.4 0.6488

Lus10039488 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.