Lus10039492 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47740 213 / 2e-69 PPPDE putative thiol peptidase family protein (.1.2)
AT5G25170 178 / 8e-57 PPPDE putative thiol peptidase family protein (.1)
AT5G47310 171 / 9e-54 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 170 / 1e-53 PPPDE putative thiol peptidase family protein (.1.2)
AT2G25190 170 / 3e-53 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 164 / 5e-51 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 160 / 4e-46 unknown protein
AT4G25680 68 / 7e-14 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 66 / 4e-13 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 50 / 2e-07 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040485 325 / 3e-114 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2)
Lus10011291 320 / 3e-112 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 221 / 3e-73 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10032708 216 / 2e-71 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10018326 178 / 1e-56 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10005341 177 / 2e-56 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 177 / 2e-56 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 173 / 6e-55 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10007844 169 / 5e-53 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G134200 237 / 2e-79 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 233 / 4e-78 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 233 / 5e-78 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 232 / 1e-77 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 229 / 3e-76 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G261500 188 / 2e-60 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 183 / 1e-58 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 168 / 1e-52 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 167 / 2e-52 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 166 / 8e-52 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10039492 pacid=23165059 polypeptide=Lus10039492 locus=Lus10039492.g ID=Lus10039492.BGIv1.0 annot-version=v1.0
ATGGATAAACAGATACTCATTATCCATACGGAACGAATAACAGCCTTTGTTACCAACACCGTCGTCGAGGTTGAAGGAGGATCACAAAAGGGTAACAGAT
GGCAGTCCATCGATACATCTCCTCTCAAGGCAAAGCTAGCTAACAAATTTTGCATCTTCCCAAAGTCAAAGAACCTAGCAAGCTACACTTGCGGCGACAC
CCCTGTTTACCTCAACGTGTATGAACTCACTACGGAAAATGGTTATGTCTACTGGGCTGGCCTTGGAATCTTTCACTCTGCTGGTGAAGTCCATGGTGTA
GAGTATGCATTTGGAGCCCATGACTTCTCGACCATCGGTGTCTTTGATGTAGAACCACAAAACTTCCTCGGTTACTTGTTCAGGAGGTCCATGTTCATGG
GGACGACCACCGTGGATCCTAAGCAGGTCAGGGAATTCATGGAGCGTCAGTCTGCTAACTACAATGGTGATACCTATCATTTGATCTGCAAGAACTGCAA
CCATTTCAGCCAGGATATCTGTTTTAAGCTCACCGGGAAGTCTATCCCTAAGTGGGTCAATCGGCTTAGCGAAAATACGTAA
AA sequence
>Lus10039492 pacid=23165059 polypeptide=Lus10039492 locus=Lus10039492.g ID=Lus10039492.BGIv1.0 annot-version=v1.0
MDKQILIIHTERITAFVTNTVVEVEGGSQKGNRWQSIDTSPLKAKLANKFCIFPKSKNLASYTCGDTPVYLNVYELTTENGYVYWAGLGIFHSAGEVHGV
EYAFGAHDFSTIGVFDVEPQNFLGYLFRRSMFMGTTTVDPKQVREFMERQSANYNGDTYHLICKNCNHFSQDICFKLTGKSIPKWVNRLSENT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47740 PPPDE putative thiol peptidase... Lus10039492 0 1

Lus10039492 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.