Lus10039494 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56710 44 / 6e-06 SIB1 sigma factor binding protein 1 (.1)
AT2G41180 42 / 3e-05 SIB2 sigma factor binding protein 2, VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039493 239 / 7e-82 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1)
Lus10024139 218 / 1e-73 AT3G56710 58 / 5e-11 sigma factor binding protein 1 (.1)
Lus10008659 62 / 7e-13 ND 44 / 4e-06
Lus10026165 62 / 9e-13 AT3G56710 44 / 3e-06 sigma factor binding protein 1 (.1)
Lus10005523 45 / 5e-06 ND 46 / 2e-06
Lus10006569 43 / 3e-05 ND 44 / 1e-05
Lus10038985 41 / 0.0001 AT3G56710 54 / 3e-09 sigma factor binding protein 1 (.1)
Lus10027279 40 / 0.0002 AT3G56710 46 / 2e-06 sigma factor binding protein 1 (.1)
Lus10022005 39 / 0.0004 AT3G56710 48 / 1e-07 sigma factor binding protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G194700 75 / 8e-18 AT3G56710 54 / 6e-10 sigma factor binding protein 1 (.1)
Potri.001G029700 66 / 3e-14 AT3G56710 54 / 5e-10 sigma factor binding protein 1 (.1)
Potri.006G038900 49 / 1e-07 AT2G41180 56 / 2e-10 sigma factor binding protein 2, VQ motif-containing protein (.1)
Potri.016G036600 45 / 2e-06 AT3G56710 48 / 2e-07 sigma factor binding protein 1 (.1)
Potri.013G043800 43 / 1e-05 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1)
Potri.019G013750 43 / 1e-05 AT3G56710 46 / 7e-07 sigma factor binding protein 1 (.1)
Potri.019G013300 42 / 1e-05 AT2G41180 47 / 3e-07 sigma factor binding protein 2, VQ motif-containing protein (.1)
Potri.016G093900 43 / 2e-05 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Lus10039494 pacid=23165268 polypeptide=Lus10039494 locus=Lus10039494.g ID=Lus10039494.BGIv1.0 annot-version=v1.0
ATGGATTACGGACTTGGTGTTAATATGAAGAGCAGGTCTAGCAGCTACAGCAAGAAGAAGAGCAACAAGGACGTCAAAGTCGTGTACATCTCAACTCCGA
TGAAGGTGAAGACGAGCGCAGCTGAATTCAGAGCTCTGGTCCAGGAGCTCACCGGCAAGGACTCCGATACCGCCAGGCTCATGGAGGTCAAAGGCAATGA
GGAGTTAATGATGATGAAGAAGAAGAAGAATACGGAAACTACAGGGACGAGGGCAGGTAATGAGTCATTGACGTCGTCGTATGATCGTGACCATCATCAT
CAGTCGTCGCCGTTCATTCACCAGCAGCAAGAGTACTCCTCCACGTGTTCGGATTATTCGGCTTCTACGGCGTCGTTGGATGAGCAGGAAGCGTTGTTGT
TGCCGATGGAGGGTAGCTTCATGAGCTTGTTTCAGCCCAGTTTTTTGACTGAATTCAAATTCAACGAGCTAGATGAGTTGAACTATTGA
AA sequence
>Lus10039494 pacid=23165268 polypeptide=Lus10039494 locus=Lus10039494.g ID=Lus10039494.BGIv1.0 annot-version=v1.0
MDYGLGVNMKSRSSSYSKKKSNKDVKVVYISTPMKVKTSAAEFRALVQELTGKDSDTARLMEVKGNEELMMMKKKKNTETTGTRAGNESLTSSYDRDHHH
QSSPFIHQQQEYSSTCSDYSASTASLDEQEALLLPMEGSFMSLFQPSFLTEFKFNELDELNY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G56710 SIB1 sigma factor binding protein 1... Lus10039494 0 1
AT1G01490 Heavy metal transport/detoxifi... Lus10027524 1.4 0.8662
AT3G56710 SIB1 sigma factor binding protein 1... Lus10024139 2.4 0.8800
AT1G01440 Protein of unknown function (D... Lus10001910 2.4 0.8624
AT4G38900 bZIP AtbZIP29 Basic-leucine zipper (bZIP) tr... Lus10018061 4.2 0.8174
AT1G47480 alpha/beta-Hydrolases superfam... Lus10034068 4.5 0.8157
AT2G42010 PLDBETA1 phospholipase D beta 1 (.1) Lus10042282 8.0 0.8589
AT5G59730 ATEXO70H7 exocyst subunit exo70 family p... Lus10005436 8.4 0.8407
Lus10000811 8.8 0.8113
AT1G32920 unknown protein Lus10001526 9.2 0.8301
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10004828 9.2 0.8057

Lus10039494 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.