Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024140 [exp] 44 / 1e-06 AT3G12250 532 / 0.0 TGACG motif-binding factor 6 (.1.2.3.4.5)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039495 pacid=23165144 polypeptide=Lus10039495 locus=Lus10039495.g ID=Lus10039495.BGIv1.0 annot-version=v1.0 ATGGCTGATACCAGCCCTAGGACAGACTTAGGGGGCGCTGACTCAGATGAGCAAAGTCCAGGGCATGTCTTGATTAGGAAGTTATTACCTATAGATATAG TAATCGAGTCCAATAAGGACTCGATCTCTCTAGCATGTAAACTCTATAAATATAGAGTTATTCTCATTCATAAATCAATCAAGAGGATTATTACTTCATA A
AA sequence Show only first row Show all	>Lus10039495 pacid=23165144 polypeptide=Lus10039495 locus=Lus10039495.g ID=Lus10039495.BGIv1.0 annot-version=v1.0 MADTSPRTDLGGADSDEQSPGHVLIRKLLPIDIVIESNKDSISLACKLYKYRVILIHKSIKRIITS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039495 [exp]	0	1
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10031478 [exp]	1.0	0.9692
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Lus10030442 [exp]	1.4	0.9165
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10041082 [exp]	1.7	0.8450
AT3G06240			F-box family protein (.1)		Lus10034007 [exp]	4.1	0.7327
AT5G49360		ATBXL1, BXL1	beta-xylosidase 1 (.1)		Lus10037728 [exp]	8.7	0.7774
AT4G31050			Biotin/lipoate A/B protein lig...		Lus10008181 [exp]	8.7	0.7339
					Lus10008920 [exp]	8.9	0.7893
AT5G01740			Nuclear transport factor 2 (NT...		Lus10022755 [exp]	9.2	0.7347
					Lus10024506 [exp]	9.4	0.7070
					Lus10031737 [exp]	10.6	0.7328

Compare expression of checked genes

Lus10039495 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.