Lus10039496 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21960 39 / 0.0004 Receptor-like protein kinase-related family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024141 219 / 1e-74 ND /
Lus10041665 40 / 0.0001 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10039496 pacid=23164985 polypeptide=Lus10039496 locus=Lus10039496.g ID=Lus10039496.BGIv1.0 annot-version=v1.0
ATGGCGATTCTGTCGTCAGTAATAAGAAAATTGTTACCTTCAGTCTTCACAGCTTATTTCCTTCTAACATTGGTTAGTACCGTAGCCTCCTTGCAGACAA
TGTGCCACCAAGACTCTGAGTCATACCAAGCTGGTGATTTCCGCATAGAGTGCATGCAAGATTTCCTGGGCCGGCTAGCTGTGGATTACAATCTCCCATC
TTCATCCTGCGACTACAACACAACCTATGACTGCAAGGGCAGCACGACTCCGCTGTACGGCTACATATGGGCGGCTGGTTGTGGCGATAGATTATCGGAT
TCGGTTTCGTGCCTGCGTACAGCTGCAGCAATGGTATACTATGGTTGCCCCAACAGCGTTGGCGGCAGGGCGTGGATCACCAATGGTGACCACTGTCTCG
TTCGGGTGGAGAACTATCCGTTTTATGCGAATTCAACTGCTTCATCCACAAATACTACGTTCTGA
AA sequence
>Lus10039496 pacid=23164985 polypeptide=Lus10039496 locus=Lus10039496.g ID=Lus10039496.BGIv1.0 annot-version=v1.0
MAILSSVIRKLLPSVFTAYFLLTLVSTVASLQTMCHQDSESYQAGDFRIECMQDFLGRLAVDYNLPSSSCDYNTTYDCKGSTTPLYGYIWAAGCGDRLSD
SVSCLRTAAAMVYYGCPNSVGGRAWITNGDHCLVRVENYPFYANSTASSTNTTF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039496 0 1
Lus10009927 1.0 0.9908
Lus10018837 1.7 0.9887
AT3G28540 P-loop containing nucleoside t... Lus10007270 2.0 0.9854
AT5G05340 Peroxidase superfamily protein... Lus10030149 2.2 0.9844
AT4G30550 GGP3 gamma-glutamyl peptidase 3, Cl... Lus10015493 2.4 0.9894
Lus10003893 3.3 0.9691
Lus10034352 3.5 0.9830
AT1G14830 DRP1C, ADL5, AD... DYNAMIN RELATED PROTEIN 1C, AR... Lus10043352 3.6 0.9618
AT3G44900 ATCHX4 cation/H+ exchanger 4, cation/... Lus10032621 3.9 0.9570
AT2G24960 unknown protein Lus10042421 4.6 0.9828

Lus10039496 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.