Lus10039498 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05200 39 / 0.0008 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018377 41 / 0.0002 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10001030 38 / 0.0006 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039498 pacid=23165190 polypeptide=Lus10039498 locus=Lus10039498.g ID=Lus10039498.BGIv1.0 annot-version=v1.0
ATGGTTGTGATTCATGCGATGGTGCTATTGGTACTAGTTATGACGATGGCCATCTGGATCAATGACTCTGCTTCGGGGTCGTCTGCGACGGTGGACAATG
ATACAACAACAAGGTCAATAATAGAGCTAAGTAACGAATACTGGCCAGTGTGCAGCACTGTGCCATTTAAAAATAGGAAGGCATTTGAATGTGTGTATTA
TCTTTTGTCGAGTATGGTCGAACGGGCCAGAAAGCCGTGTCAGCCGGATGAATCGCAAACGGACGCTTGCATCAACGACCTGACTGTGTACACTAAGATT
AACTCTTACAACACCTTTGATTGGGATTGTCGTCCATGTTTTCGACAAGCACTGGATCTGCTCTGGAATAATTGTTACGGCATGGTTGGAGGCTCCGTTA
AATTGGATAGTGTTCCTCGTTGCGAGATCAGATTCGAGATCTATCCGTTCAAGTTGTAA
AA sequence
>Lus10039498 pacid=23165190 polypeptide=Lus10039498 locus=Lus10039498.g ID=Lus10039498.BGIv1.0 annot-version=v1.0
MVVIHAMVLLVLVMTMAIWINDSASGSSATVDNDTTTRSIIELSNEYWPVCSTVPFKNRKAFECVYYLLSSMVERARKPCQPDESQTDACINDLTVYTKI
NSYNTFDWDCRPCFRQALDLLWNNCYGMVGGSVKLDSVPRCEIRFEIYPFKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039498 0 1
AT2G24210 AtTPS10 terpene synthase 10 (.1) Lus10006355 3.2 0.8841
AT5G47700 60S acidic ribosomal protein f... Lus10033403 5.3 0.8593
AT1G78980 SRF5 STRUBBELIG-receptor family 5 (... Lus10037294 6.2 0.8616
AT4G37320 CYP81D5 "cytochrome P450, family 81, s... Lus10024818 9.5 0.8661
AT1G67290 GLOX1 glyoxal oxidase 1, glyoxal oxi... Lus10012980 9.7 0.8536
AT5G16120 alpha/beta-Hydrolases superfam... Lus10028475 12.1 0.8455
AT1G78570 ATRHM1, RHM1, R... REPRESSOR OF LRX1 1, ARABIDOPS... Lus10010942 12.5 0.8299
AT3G24503 ALDH1A, REF1, A... REDUCED EPIDERMAL FLUORESCENCE... Lus10023625 14.7 0.8457
AT3G59160 F-box/RNI-like superfamily pro... Lus10003943 14.9 0.8273
AT1G67290 GLOX1 glyoxal oxidase 1, glyoxal oxi... Lus10012981 15.6 0.8410

Lus10039498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.