Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06730 236 / 6e-80 TRXz, TRXP ,TRX z thioredoxin putative plastidic, Thioredoxin z (.1) AT1G50320 62 / 5e-12 ATHX, ATX thioredoxin X (.1) AT1G43560 59 / 4e-11 ATY2 thioredoxin Y2 (.1) AT3G15360 57 / 3e-10 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT4G03520 56 / 1e-09 ATHM2 Thioredoxin superfamily protein (.1.2) AT1G19730 53 / 2e-09 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT1G76760 54 / 4e-09 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT5G60640 52 / 4e-08 ATPDI2, ATPDIL1-4 ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 2, PDI-like 1-4 (.1.2.3) AT1G11530 49 / 6e-08 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT1G03680 50 / 9e-08 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042784 [exp] 71 / 2e-15 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 71 / 2e-15 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 71 / 3e-15 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10028569 [exp] 69 / 9e-15 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10018875 [exp] 66 / 1e-13 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10019847 [exp] 61 / 1e-11 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10014069 [exp] 60 / 2e-11 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10014798 [exp] 57 / 4e-10 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 56 / 5e-10 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G028500 [exp] 248 / 6e-85 AT3G06730 244 / 2e-83 thioredoxin putative plastidic, Thioredoxin z (.1) Potri.005G186800 [exp] 65 / 2e-13 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 64 / 2e-12 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.007G074000 [exp] 60 / 2e-11 AT1G50320 201 / 3e-66 thioredoxin X (.1) Potri.005G058400 [exp] 60 / 2e-11 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.009G100700 [exp] 60 / 2e-11 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 58 / 1e-10 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.011G120700 [exp] 57 / 3e-10 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.002G066800 [exp] 56 / 8e-10 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1) Potri.019G111200 [exp] 56 / 1e-09 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10039499 pacid=23165182 polypeptide=Lus10039499 locus=Lus10039499.g ID=Lus10039499.BGIv1.0 annot-version=v1.0 ATGACTGCTATTCTCCACACTCACTCACCATCTTATTTCTCCACATCCAGCTTCTCTCCTTCCTCCAATTCATCTCGCCCTTCTCTCCCTTCTTCTACTT CTTCTTCTTCGTCTCTCAGTTTCCCTCTCCACAAAGGCTCTCTCCTTTCCTTCGCCAAACCTCAATTCTCCCTCTCAACCCAACCAAGACGCCTGCTTTG CGCTCCTCCTCGTGGAAAATACATCAGAGACGACTATCTTGTGAAAAAGAAGAGTGCAGAGGAAATAGAGGAGCTGGTTAGGGGAGAAAGAAGTGTACCC CTTGTTATTGACTTCTATGCAACATGGTGTGGCCCTTGTATCCTCATGGCACAAGAGATTGAAATGCTTGCTGTGGAGTATGAGAGCAAAGCAATGATTG TCAAGGTTGAAACCGACGATGAGTATGAGTTTGCAAGAGATATGCAGGTTAGAGGTCTGCCGACGCTGTTATTCATCAGTCCGGATCCAAATAAGGATGC AATCAGAACTGAAGGACTCATCCCAATCCAAATGATGAGAGATATCCTTGACAATGAAATGTGA
AA sequence Show only first row Show all	>Lus10039499 pacid=23165182 polypeptide=Lus10039499 locus=Lus10039499.g ID=Lus10039499.BGIv1.0 annot-version=v1.0 MTAILHTHSPSYFSTSSFSPSSNSSRPSLPSSTSSSSSLSFPLHKGSLLSFAKPQFSLSTQPRRLLCAPPRGKYIRDDYLVKKKSAEEIEELVRGERSVP LVIDFYATWCGPCILMAQEIEMLAVEYESKAMIVKVETDDEYEFARDMQVRGLPTLLFISPDPNKDAIRTEGLIPIQMMRDILDNEM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G06730		TRXz, TRXP ,TRX...	thioredoxin putative plastidic...		Lus10039499 [exp]	0	1
AT1G10522			unknown protein		Lus10030655 [exp]	1.0	0.9552
AT3G20230			Ribosomal L18p/L5e family prot...		Lus10020797 [exp]	1.4	0.9467
AT2G34640		HMR, PTAC12	HEMERA, plastid transcriptiona...		Lus10023283 [exp]	3.9	0.9345
AT1G02560		NCLPP5, NCLPP1,...	NUCLEAR CLPP 5, NUCLEAR-ENCODE...		Lus10001450 [exp]	4.0	0.9356
AT2G34640		HMR, PTAC12	HEMERA, plastid transcriptiona...		Lus10038523 [exp]	4.7	0.9192
AT3G54090		FLN1	fructokinase-like 1 (.1)		Lus10017191 [exp]	4.9	0.9368
AT1G55140			Ribonuclease III family protei...		Lus10037645 [exp]	7.3	0.9293
AT3G20230			Ribosomal L18p/L5e family prot...		Lus10007379 [exp]	8.4	0.9194
AT1G30680			toprim domain-containing prote...		Lus10023379 [exp]	9.5	0.9147
AT3G56330			N2,N2-dimethylguanosine tRNA m...		Lus10030535 [exp]	10.6	0.9019

Compare expression of checked genes

Lus10039499 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.