Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021668 [exp] 65 / 1e-13 ND / Lus10023787 [exp] 66 / 2e-13 ND 44 / 3e-04 Lus10023767 [exp] 65 / 2e-13 ND / Lus10006887 [exp] 64 / 8e-13 AT4G19130 63 / 7e-10 Replication factor-A protein 1-related (.1) Lus10027612 [exp] 64 / 1e-12 AT1G52950 49 / 1e-05 Nucleic acid-binding, OB-fold-like protein (.1) Lus10042979 [exp] 63 / 2e-12 AT5G08020 54 / 5e-07 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1) Lus10039353 [exp] 63 / 2e-12 ND / Lus10023006 [exp] 63 / 2e-12 ND / Lus10006918 [exp] 59 / 3e-11 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039504 pacid=23165185 polypeptide=Lus10039504 locus=Lus10039504.g ID=Lus10039504.BGIv1.0 annot-version=v1.0 ATGGCACTCCGCCAGCTTACGCCGGAAAACCCACCTCCCCATCTTGAGCTCCGTCTGCAACAAGTATGGAAGCTCGGGAATCCTTCCACGCCCGATCAAT ACTTCGCCTTGGGTACCATTTGGACAGACGCCGAGTTTCCCGTGCGGTCATGTAGAGAATTAATGGGTGGGATGGAACCATCCCTGAATCATAGTGTTGG AGCATCTCCCTGGCTTAAGAATCTCAAATCAAAGCTCATGAAATTTGACGCTGATCCAAACTGCTTCATTAGAGTGTACGGATTGTATGTTGAAAAGGGT ATTTACAAGTTACGGGAAGGACTGGTTATGAGGATGGTGGTTGCCATTTGTCATCGTTAG
AA sequence Show only first row Show all	>Lus10039504 pacid=23165185 polypeptide=Lus10039504 locus=Lus10039504.g ID=Lus10039504.BGIv1.0 annot-version=v1.0 MALRQLTPENPPPHLELRLQQVWKLGNPSTPDQYFALGTIWTDAEFPVRSCRELMGGMEPSLNHSVGASPWLKNLKSKLMKFDADPNCFIRVYGLYVEKG IYKLREGLVMRMVVAICHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039504 [exp]	0	1
AT5G35750		AHK2	histidine kinase 2 (.1)		Lus10012325 [exp]	5.1	0.6995
AT3G09180			unknown protein		Lus10016953 [exp]	8.2	0.7319
AT5G17210			Protein of unknown function (D...		Lus10007189 [exp]	15.1	0.6875
AT4G14720	ZIM	TIFY4B, PPD2	PEAPOD 2, TIFY domain/Divergen...		Lus10014700 [exp]	31.0	0.6338
AT1G43190		PTB3	polypyrimidine tract-binding p...		Lus10028566 [exp]	35.0	0.6711
AT1G69220		SIK1	Protein kinase superfamily pro...		Lus10036915 [exp]	40.6	0.6238
AT3G25800		PP2AA2, PR65, P...	protein phosphatase 2A subuni...		Lus10034299 [exp]	43.5	0.6390
AT5G46290		KAS1, KAS I, KA...	KETOACYL-ACP SYNTHASE 1, 3-ket...		Lus10001814 [exp]	55.6	0.5968
AT1G16590		REV7, ATREV7	DNA-binding HORMA family prote...		Lus10006836 [exp]	76.8	0.5911
AT5G35980		YAK1	yeast YAK1-related gene 1 (.1....		Lus10020366 [exp]	90.3	0.6042

Compare expression of checked genes

Lus10039504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.