Lus10039510 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039510 pacid=23165117 polypeptide=Lus10039510 locus=Lus10039510.g ID=Lus10039510.BGIv1.0 annot-version=v1.0
ATGGCGGTTGACTTGTGTTTAACCGTTGTTCAGTCTTGTAATAAAGGTTCAGGTGTACATGAAGTAAATGTAACAGTCATTTGTTACCGAGTTGCATGGG
ATCAGTTATCATCATTGTTTATGGGAAGAGTGGCAGGCATTTTGAATTGGAAACTGAAGCATGGGAGAATTTCTTCGGGGCATAGCATAGAGAGGGCAAA
CTTGTTAGCAGCAAAAGTGCGAAAAGTGAAGTTGGGTTTTGCTAAAGATATTGTCATGGAGATTGTGACTGCAACAATGCTGTACACAAAGAGAAACAGT
AGGGTTCCGTTGAAATCGAGACTACAACGGATGAGATGA
AA sequence
>Lus10039510 pacid=23165117 polypeptide=Lus10039510 locus=Lus10039510.g ID=Lus10039510.BGIv1.0 annot-version=v1.0
MAVDLCLTVVQSCNKGSGVHEVNVTVICYRVAWDQLSSLFMGRVAGILNWKLKHGRISSGHSIERANLLAAKVRKVKLGFAKDIVMEIVTATMLYTKRNS
RVPLKSRLQRMR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039510 0 1
AT1G55190 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, ... Lus10033859 7.7 0.6427
AT4G09830 Uncharacterised conserved prot... Lus10028732 20.5 0.6348
AT5G65630 GTE7 global transcription factor gr... Lus10010525 23.3 0.6258
AT2G32440 ATKAO2, CYP88A4... ARABIDOPSIS ENT-KAURENOIC ACID... Lus10000026 27.8 0.6311
AT1G78810 unknown protein Lus10028833 29.7 0.5827
Lus10009611 34.2 0.5877
AT4G24050 NAD(P)-binding Rossmann-fold s... Lus10017308 62.7 0.5583
AT1G07710 Ankyrin repeat family protein ... Lus10015224 70.3 0.5861
AT1G44750 ATPUP11 purine permease 11 (.1.2.3) Lus10043350 73.7 0.5773
AT2G28310 Protein of unknown function (D... Lus10000145 76.7 0.5560

Lus10039510 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.