Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48485 53 / 2e-10 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 49 / 9e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55450 40 / 1e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002741 [exp] 73 / 3e-18 AT5G48490 74 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016323 [exp] 73 / 4e-18 AT5G48490 74 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025866 [exp] 49 / 6e-09 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038233 [exp] 49 / 6e-09 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G149900 [exp] 66 / 2e-15 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G251000 [exp] 51 / 9e-10 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10039511 pacid=23165075 polypeptide=Lus10039511 locus=Lus10039511.g ID=Lus10039511.BGIv1.0 annot-version=v1.0 ATGGTTGTGGTGCTAATAATAGTAATGGTAAAGATGGGAGAAGGTCAAGTTATATGCAATATTCCGGTGGAAGGGCTGAGAGCTTGCAAGCCGGCGGTGA CTCCTCCGAGACCATCCCCGCCGACAAGAGATTGCTGCTCAGCGGTGTCCCACGGAAATATGCGTTGCCTATGTGGATACAAGAACTCCCCTCTGCTTCC TTCCCTTGGGGTTGACCCAAAACTCGTCGTCCAGCTTCCTGGAAAGTGTGGCCTCCCTCCCCCTCCTTGTTAA
AA sequence Show only first row Show all	>Lus10039511 pacid=23165075 polypeptide=Lus10039511 locus=Lus10039511.g ID=Lus10039511.BGIv1.0 annot-version=v1.0 MVVVLIIVMVKMGEGQVICNIPVEGLRACKPAVTPPRPSPPTRDCCSAVSHGNMRCLCGYKNSPLLPSLGVDPKLVVQLPGKCGLPPPPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48485		DIR1	DEFECTIVE IN INDUCED RESISTANC...		Lus10039511 [exp]	0	1
AT5G05280			RING/U-box superfamily protein...		Lus10034228 [exp]	1.0	0.9675
AT2G25625			unknown protein		Lus10013129 [exp]	1.7	0.9360
AT3G10910			RING/U-box superfamily protein...		Lus10029037 [exp]	2.8	0.9364
AT1G15960		ATNRAMP6, NRAMP...	NRAMP metal ion transporter 6 ...		Lus10024069 [exp]	3.5	0.9217
AT4G36930	bHLH	SPT, bHLH024	SPATULA, basic helix-loop-heli...		Lus10038020 [exp]	4.5	0.9223
AT1G06460		ACD31.2, ACD32....	ALPHA-CRYSTALLIN DOMAIN 31.2, ...		Lus10007366 [exp]	4.5	0.9272
AT5G45380		ATDUR3	DEGRADATION OF UREA 3, solute:...		Lus10033882 [exp]	6.7	0.9209
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10026009 [exp]	7.5	0.9212
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Lus10002979 [exp]	7.5	0.9211
AT1G21065			unknown protein		Lus10016049 [exp]	9.2	0.9056

Compare expression of checked genes

Lus10039511 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.