Lus10039523 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G34930 103 / 2e-25 disease resistance family protein / LRR family protein (.1)
AT3G11080 97 / 5e-23 AtRLP35 receptor like protein 35 (.1)
AT3G28890 95 / 2e-22 AtRLP43 receptor like protein 43 (.1.2)
AT5G23400 95 / 2e-22 Leucine-rich repeat (LRR) family protein (.1)
AT5G27060 94 / 3e-22 AtRLP53 receptor like protein 53 (.1)
AT3G05660 93 / 8e-22 AtRLP33 receptor like protein 33 (.1)
AT5G21090 89 / 1e-21 Leucine-rich repeat (LRR) family protein (.1)
AT3G43740 88 / 2e-21 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
AT1G33610 89 / 3e-20 Leucine-rich repeat (LRR) family protein (.1)
AT5G01890 89 / 3e-20 Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016337 194 / 3e-57 AT2G34930 471 / 6e-151 disease resistance family protein / LRR family protein (.1)
Lus10039531 194 / 6e-57 AT2G34930 485 / 2e-156 disease resistance family protein / LRR family protein (.1)
Lus10016338 186 / 3e-54 AT2G34930 387 / 3e-121 disease resistance family protein / LRR family protein (.1)
Lus10016339 179 / 9e-52 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1)
Lus10016340 178 / 3e-51 AT2G34930 492 / 8e-159 disease resistance family protein / LRR family protein (.1)
Lus10001035 177 / 3e-51 AT2G34930 488 / 9e-157 disease resistance family protein / LRR family protein (.1)
Lus10016341 177 / 4e-51 AT2G34930 482 / 3e-155 disease resistance family protein / LRR family protein (.1)
Lus10002755 171 / 4e-49 AT2G34930 467 / 2e-149 disease resistance family protein / LRR family protein (.1)
Lus10002758 169 / 3e-48 AT2G34930 443 / 1e-140 disease resistance family protein / LRR family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G196832 124 / 4e-33 AT2G34930 203 / 8e-57 disease resistance family protein / LRR family protein (.1)
Potri.001G027500 119 / 1e-32 AT2G34930 130 / 1e-33 disease resistance family protein / LRR family protein (.1)
Potri.010G107000 114 / 3e-29 AT2G34930 504 / 1e-163 disease resistance family protein / LRR family protein (.1)
Potri.010G106900 112 / 2e-28 AT2G34930 506 / 1e-164 disease resistance family protein / LRR family protein (.1)
Potri.015G025800 105 / 5e-26 AT2G34930 375 / 3e-115 disease resistance family protein / LRR family protein (.1)
Potri.015G024600 105 / 5e-26 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1)
Potri.015G025200 105 / 5e-26 AT2G34930 414 / 7e-130 disease resistance family protein / LRR family protein (.1)
Potri.001G043800 104 / 1e-25 AT2G34930 383 / 7e-119 disease resistance family protein / LRR family protein (.1)
Potri.012G034600 100 / 2e-24 AT2G34930 434 / 1e-137 disease resistance family protein / LRR family protein (.1)
Potri.015G025300 97 / 3e-23 AT2G34930 314 / 1e-91 disease resistance family protein / LRR family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
CL0022 PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Lus10039523 pacid=23165345 polypeptide=Lus10039523 locus=Lus10039523.g ID=Lus10039523.BGIv1.0 annot-version=v1.0
ATGACAGCTCATGCTGCAGTGCTTCTCCTCTGGCTGAGCTTCATGTGTTTCTGCAATCAAAGTTCTTCTAATGCAGGCCTCCTATGCAATCAGGCTGAAA
AAGAAGCCCTATTGAATTTCAAGGCTGATCTCCAAGACCCTTCAAGCCGCCTATCTTCCTGGGTTGCCAGTAATGGCGATTGTTGTAAATGGTCTGGTGT
TACTTGTGGCAACATTACTGGCCATGTTACTCGCCTTTTTCTACAATGCCTTCATTGTGGCGAACATACTATGCTTCAAGGTAAGGTAAATCCTTCCTTG
CTTGAGTTGAAGCATCTTACTTATCTGGACCTCTCAGGCAACAAAGTTCAAGGGGTTACTATCACAGCGTTTATTGGGTCTATGATCAGTTTGACTTCTC
TTTTCCTTGATGGATCTGAATTTGGGGGTCTTATCCCACATCAGCTAGAAATCTCTCAAATCTGCAACAACTCAGTCTTCAGCTTGACATCTCTGGATCT
AGGAGCAAACAGTTTCATAGGTCCAATCCCTGATAAGCTGCAAACCCTTACCTCTCTAAGGACTCTTGATATGTCTTCCAACGAGTTCAATGGTTCCATA
CCAAGCTGGCTGTTCGGTTTCCACCTCTTGAGGGCCTTGATTTAA
AA sequence
>Lus10039523 pacid=23165345 polypeptide=Lus10039523 locus=Lus10039523.g ID=Lus10039523.BGIv1.0 annot-version=v1.0
MTAHAAVLLLWLSFMCFCNQSSSNAGLLCNQAEKEALLNFKADLQDPSSRLSSWVASNGDCCKWSGVTCGNITGHVTRLFLQCLHCGEHTMLQGKVNPSL
LELKHLTYLDLSGNKVQGVTITAFIGSMISLTSLFLDGSEFGGLIPHQLEISQICNNSVFSLTSLDLGANSFIGPIPDKLQTLTSLRTLDMSSNEFNGSI
PSWLFGFHLLRALI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G34930 disease resistance family prot... Lus10039523 0 1
AT2G34930 disease resistance family prot... Lus10039522 1.4 0.7764
Lus10026392 6.6 0.7333
AT2G34930 disease resistance family prot... Lus10029483 13.0 0.7258
Lus10004065 13.9 0.7267
Lus10038304 17.0 0.6701
Lus10005948 20.1 0.6816
AT3G63420 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) Lus10029687 21.9 0.6696
AT4G19380 Long-chain fatty alcohol dehyd... Lus10037257 23.0 0.7056
AT1G12920 ERF1-2 eukaryotic release factor 1-2 ... Lus10026003 36.7 0.6113
AT5G08560 transducin family protein / WD... Lus10001412 37.2 0.7240

Lus10039523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.