Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57040 201 / 3e-65 ATRR4, ARR9 RESPONSE REGULATOR 4, response regulator 9 (.1) AT2G41310 192 / 1e-61 ARR8, ATRR3 RESPONSE REGULATOR 8, response regulator 3 (.1) AT1G59940 164 / 1e-50 ARR3 response regulator 3 (.1) AT1G10470 164 / 2e-50 IBC7, ATRR1, ARR4, MEE7 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) AT3G56380 159 / 2e-49 ARR17 response regulator 17 (.1) AT2G40670 155 / 6e-48 ARR16 response regulator 16 (.1.2) AT3G48100 155 / 1e-47 ATRR2, IBC6, ARR5 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) AT5G62920 154 / 4e-47 ARR6 response regulator 6 (.1) AT1G74890 154 / 6e-47 ARR15 response regulator 15 (.1) AT1G19050 153 / 1e-46 ARR7 response regulator 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016334 [exp] 234 / 4e-78 AT3G57040 211 / 5e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10002750 [exp] 226 / 5e-75 AT3G57040 212 / 4e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10042153 [exp] 160 / 1e-49 AT3G48100 213 / 1e-70 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10004243 [exp] 158 / 1e-48 AT3G48100 220 / 2e-73 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10030664 [exp] 154 / 6e-46 AT1G10470 206 / 2e-65 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10029211 [exp] 152 / 9e-46 AT1G10470 211 / 4e-68 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10030822 [exp] 152 / 2e-45 AT1G59940 201 / 2e-64 response regulator 3 (.1) Lus10042938 [exp] 119 / 3e-33 AT1G19050 153 / 7e-47 response regulator 7 (.1) Lus10030359 [exp] 115 / 7e-32 AT2G41310 142 / 3e-42 RESPONSE REGULATOR 8, response regulator 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T124806 [exp] 225 / 4e-75 AT2G41310 232 / 6e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.001G027000 [exp] 225 / 4e-75 AT2G41310 203 / 2e-66 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.003G197466 [exp] 224 / 7e-75 AT2G41310 232 / 5e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.016G038000 [exp] 214 / 2e-70 AT2G41310 242 / 2e-81 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.006G041100 [exp] 214 / 4e-70 AT3G57040 273 / 4e-93 RESPONSE REGULATOR 4, response regulator 9 (.1) Potri.002G082200 [exp] 177 / 1e-55 AT3G57040 180 / 1e-56 RESPONSE REGULATOR 4, response regulator 9 (.1) Potri.019G058900 [exp] 161 / 1e-50 AT3G56380 223 / 5e-76 response regulator 17 (.1) Potri.010G037800 [exp] 163 / 7e-50 AT1G59940 202 / 5e-65 response regulator 3 (.1) Potri.019G133600 [exp] 154 / 8e-48 AT3G56380 183 / 2e-60 response regulator 17 (.1) Potri.015G070000 [exp] 155 / 3e-47 AT3G48100 231 / 1e-77 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [flax] [poplar] CheY PF00072 [flax] [poplar] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Lus10039524 pacid=23165255 polypeptide=Lus10039524 locus=Lus10039524.g ID=Lus10039524.BGIv1.0 annot-version=v1.0 ATGGGTATGTCTATTGCTGAAGCTCCACATCAGTTCCATGTTCTTGCTGTCGATGACAGCATCATTGACAGGAAGTTGATTGAGAGGCTCCTCAAGACCT CTTCTTATCAAGTCACATCAGTTGATTCAGGGAGTAAGGCACTTGAGTTTCTAGGCCTGATGAATAACACCAGTAGTACTGACGATGATGATGAAGATGA TGAAGAAGAAGATAGGGATTCTTCTGCCTCTGCCTCTCCCTCTAATGAGAATGATGCTGAAGTAAATTTGATCATCACTGATTACTGCATGCCTGGGATG ACTGGCTACGACCTCCTTAGGAGAATCAAGGAGTCCAAATCATTGAGGGACATTCCAGTTGTGATCATGTCTTCAGAGAATGTCCCATCTAGAATCAACA GATGTCTGGAAGAAGGAGCACAGGAGTTTTTCCTGAAGCCAGTTCAGTTATCAGATGTCAACAAACTGAAACCTCATCTCTTGCGGAAGGGAATCAGGTC CAGCAGCAGCAACCAAGGGGATTATGATGATCATGATGATGACATTGTAGAGATTAAGAACGTCAATAACAGTAAGAGAAAAGGCGAGGAGGAAGATTTC GATTCCCCTGACAAGACAAGAACCAGATACAGTGGCTTGGAATTTGTCCAATGA
AA sequence Show only first row Show all	>Lus10039524 pacid=23165255 polypeptide=Lus10039524 locus=Lus10039524.g ID=Lus10039524.BGIv1.0 annot-version=v1.0 MGMSIAEAPHQFHVLAVDDSIIDRKLIERLLKTSSYQVTSVDSGSKALEFLGLMNNTSSTDDDDEDDEEEDRDSSASASPSNENDAEVNLIITDYCMPGM TGYDLLRRIKESKSLRDIPVVIMSSENVPSRINRCLEEGAQEFFLKPVQLSDVNKLKPHLLRKGIRSSSSNQGDYDDHDDDIVEIKNVNNSKRKGEEEDF DSPDKTRTRYSGLEFVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57040		ATRR4, ARR9	RESPONSE REGULATOR 4, response...		Lus10039524 [exp]	0	1
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10027143 [exp]	1.7	0.9072
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10017558 [exp]	4.0	0.8566
AT1G10470		IBC7, ATRR1, AR...	maternal effect embryo arrest ...		Lus10030664 [exp]	4.2	0.8540
AT5G15290		CASP5	Casparian strip membrane domai...		Lus10015375 [exp]	5.1	0.8952
AT1G19230			Riboflavin synthase-like super...		Lus10034890 [exp]	6.9	0.8840
AT5G47950			HXXXD-type acyl-transferase fa...		Lus10002893 [exp]	8.3	0.8938
AT4G11290			Peroxidase superfamily protein...		Lus10028688 [exp]	10.4	0.8645
AT1G03220			Eukaryotic aspartyl protease f...		Lus10021938 [exp]	10.7	0.8777
AT5G58030			Transport protein particle (TR...		Lus10003634 [exp]	11.8	0.8228
AT5G35740			Carbohydrate-binding X8 domain...		Lus10012324 [exp]	13.7	0.8699

Compare expression of checked genes

Lus10039524 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.