Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07910 83 / 5e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G197801 [exp] 92 / 2e-26 AT3G07910 87 / 1e-24 unknown protein Potri.T125106 [exp] 92 / 2e-26 AT3G07910 87 / 1e-24 unknown protein Potri.009G071900 [exp] 92 / 2e-26 AT3G07910 75 / 1e-19 unknown protein Potri.001G277100 [exp] 92 / 3e-26 AT3G07910 72 / 2e-18 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0500 [flax] [poplar] Glycine-zipper PF10247 [flax] [poplar] Romo1 Reactive mitochondrial oxygen species modulator 1
Representative CDS sequence Show only first row Show all	>Lus10039527 pacid=23165063 polypeptide=Lus10039527 locus=Lus10039527.g ID=Lus10039527.BGIv1.0 annot-version=v1.0 ATGGCGAGAGATAGTTGCTTGACGCGTGTGGTTGCCGGCGTTGCCATCGGCGGTGGTGTTGGTGGCGCTGTAGGTGCTGTATATGGAACTTATGAGGCCA TTAGGCATAAGGTGCCGGGACTACTGAAAATAAGGTACATAGGGCAAACAACAGTTTCGAGCGCAGCAATTTTTGGGCTCTTCTTGGGAGCAGGAAGCTT GATTCATTGCGGGAAATGA
AA sequence Show only first row Show all	>Lus10039527 pacid=23165063 polypeptide=Lus10039527 locus=Lus10039527.g ID=Lus10039527.BGIv1.0 annot-version=v1.0 MARDSCLTRVVAGVAIGGGVGGAVGAVYGTYEAIRHKVPGLLKIRYIGQTTVSSAAIFGLFLGAGSLIHCGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07910			unknown protein		Lus10039527 [exp]	0	1
AT3G05070			unknown protein		Lus10026367 [exp]	2.2	0.8998
AT1G05205			unknown protein		Lus10039669 [exp]	4.2	0.8962
AT5G53650			unknown protein		Lus10008848 [exp]	6.0	0.8768
AT1G76860			Small nuclear ribonucleoprotei...		Lus10011293 [exp]	8.1	0.8418
AT2G36130			Cyclophilin-like peptidyl-prol...		Lus10017010 [exp]	8.5	0.8720
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10017586 [exp]	10.8	0.7777
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10026854 [exp]	16.4	0.8028
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10041194 [exp]	16.7	0.8499
AT5G13340			unknown protein		Lus10035960 [exp]	19.4	0.8215
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10033547 [exp]	20.1	0.7979

Compare expression of checked genes

Lus10039527 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.