Lus10039528 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70600 264 / 2e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G23290 258 / 4e-90 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G12960 131 / 1e-40 Ribosomal protein L18e/L15 superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024161 295 / 2e-104 AT1G70600 263 / 6e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10036855 279 / 2e-98 AT1G70600 255 / 8e-89 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10006207 278 / 6e-98 AT1G70600 254 / 1e-88 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10004617 277 / 1e-97 AT1G23290 258 / 5e-90 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10016336 277 / 2e-97 AT1G23290 253 / 3e-88 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10026698 275 / 1e-96 AT1G23290 256 / 2e-89 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G202300 280 / 1e-98 AT1G70600 238 / 5e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.008G187000 277 / 1e-97 AT1G70600 238 / 3e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.016G069000 276 / 2e-97 AT1G70600 268 / 7e-94 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.010G045800 276 / 3e-97 AT1G70600 237 / 1e-81 Ribosomal protein L18e/L15 superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10039528 pacid=23165147 polypeptide=Lus10039528 locus=Lus10039528.g ID=Lus10039528.BGIv1.0 annot-version=v1.0
ATGACGACCCGCTTCAAGAAGAATCGCAAGAAGAGAGGTCATGTCAGCGCCGGACACGGTCGTATCGGAAAGCACAGGAAGCATCCGGGAGGTCGCGGTA
ACGCCGGAGGTATGCACCACCACAGGATCCTCTTCGACAAGTACCATCCAGGTTACTTCGGGAAAGTTGGTATGAGATACTTCCACAAGCTCAAGAACAG
GTTCTTCTGCCCGATCGTGAACATCGACAAGCTCTGGTCGTTGGTCCCTCAGGAGGTGAAGGATAAGGCAGGAAAGGATGCAGCTCCGATGATTGACGTC
ACTCAGTTCGGTTACTTCAAGGTGCTTGGTAAGGGTGTGTTGCCTGATAACCAGCCAATCGTGGTGAAGGCTAAGCTGGTGTCCAAGCAAGCTGAGAAGA
AGATCAAAGAAGCAGGGGGTGCTGTGGTTCTTACTGCCTAA
AA sequence
>Lus10039528 pacid=23165147 polypeptide=Lus10039528 locus=Lus10039528.g ID=Lus10039528.BGIv1.0 annot-version=v1.0
MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLKNRFFCPIVNIDKLWSLVPQEVKDKAGKDAAPMIDV
TQFGYFKVLGKGVLPDNQPIVVKAKLVSKQAEKKIKEAGGAVVLTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10039528 0 1
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10024161 2.8 0.8637
AT5G60670 Ribosomal protein L11 family p... Lus10026506 4.7 0.8572
AT5G62300 Ribosomal protein S10p/S20e fa... Lus10031705 7.5 0.7722
AT2G33370 Ribosomal protein L14p/L23e fa... Lus10042695 9.4 0.7641
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10024943 9.4 0.7946
AT5G60670 Ribosomal protein L11 family p... Lus10019935 12.1 0.8085
AT4G15000 Ribosomal L27e protein family ... Lus10010461 17.8 0.7746
AT4G17520 Hyaluronan / mRNA binding fami... Lus10000599 19.3 0.7378
AT1G03510 Tetratricopeptide repeat (TPR)... Lus10018543 20.7 0.6973
AT1G02370 Tetratricopeptide repeat (TPR)... Lus10021053 21.0 0.7741

Lus10039528 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.