Lus10039561 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 154 / 1e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 153 / 3e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 152 / 5e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 151 / 1e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 148 / 3e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 146 / 9e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 145 / 5e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT5G42510 144 / 7e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G38700 134 / 5e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029306 176 / 6e-56 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017231 167 / 1e-52 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 161 / 3e-50 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 160 / 4e-50 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025065 150 / 1e-45 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 149 / 1e-45 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 147 / 5e-45 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 146 / 2e-44 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 147 / 3e-44 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G023800 230 / 1e-77 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 181 / 4e-58 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G131000 179 / 1e-57 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 178 / 3e-57 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 177 / 1e-56 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 172 / 6e-55 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023600 172 / 7e-55 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 170 / 8e-54 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216300 169 / 3e-53 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G009100 167 / 8e-53 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10039561 pacid=23165173 polypeptide=Lus10039561 locus=Lus10039561.g ID=Lus10039561.BGIv1.0 annot-version=v1.0
ATGTCTTCTGCTTCTTCTCATTACCTTTTCGCCGCCACCATCTGCTGCATACTACTATGTACACCTCTTGTTTCCACTATTCATGCAGCATTCTCTGAGG
AAATATTCGAAGGAATAGCCATAAAACGTATAGAGAAATCCGTCCATCTTCATTTCTACTTCCATGACATCCTCAGTGGCAAGAATCCTTCAGCTGTGCG
GATTGCTGGCCCTGCTGATGGTTCAATGGCCGCATTTGGGAACACCATGGCAATGGACGATCCATTGACCGAAGGACCTGAAGCGAGCTCCAAGGTGATC
GGTAAAGCTCAAGGGCTGTACTCTTTGGCCTCCAGGGATGATTTCTCGTTGCTGATGGTCATGAACTTTGCCTTCACTCAAGGTAACTACACTGGAAGCA
GCATCAGCATTCTGGGGAGGAACCCAATCATGGATGACCAGAGAGAGATGCCAATCGTCGGAGGGTGCGGGGTGTTTAAGGAAGCTCGAGGAAACGTGAT
GGCGCATACTTACTGGTTTGATCCCAAAACTGGGGATGCCATTGTCGAATATAACGCTTATGTGAGGTATACCTCATAG
AA sequence
>Lus10039561 pacid=23165173 polypeptide=Lus10039561 locus=Lus10039561.g ID=Lus10039561.BGIv1.0 annot-version=v1.0
MSSASSHYLFAATICCILLCTPLVSTIHAAFSEEIFEGIAIKRIEKSVHLHFYFHDILSGKNPSAVRIAGPADGSMAAFGNTMAMDDPLTEGPEASSKVI
GKAQGLYSLASRDDFSLLMVMNFAFTQGNYTGSSISILGRNPIMDDQREMPIVGGCGVFKEARGNVMAHTYWFDPKTGDAIVEYNAYVRYTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13650 Disease resistance-responsive ... Lus10039561 0 1
AT5G22980 SCPL47 serine carboxypeptidase-like 4... Lus10000147 1.4 0.9944
AT3G45010 SCPL48 serine carboxypeptidase-like 4... Lus10041339 2.8 0.9912
AT3G62160 HXXXD-type acyl-transferase fa... Lus10004527 4.6 0.9888
AT4G35350 XCP1 xylem cysteine peptidase 1 (.1... Lus10030722 6.3 0.9878
AT3G10410 CPY, SCPL49 CARBOXYPEPTIDASE Y, SERINE CAR... Lus10037381 6.9 0.9861
AT1G43790 TED6 tracheary element differentiat... Lus10018925 7.1 0.9863
AT1G12260 NAC ANAC007, VND4, ... VASCULAR RELATED NAC-DOMAIN PR... Lus10031721 7.3 0.9833
AT1G10460 GLP7 germin-like protein 7 (.1) Lus10029214 7.5 0.9855
AT1G76250 unknown protein Lus10012274 7.5 0.9735
AT1G23460 Pectin lyase-like superfamily ... Lus10030602 7.7 0.9811

Lus10039561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.