Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62950 78 / 1e-19 RNA polymerase II, Rpb4, core protein (.1.2.3) AT3G28956 71 / 2e-16 RNA polymerase II, Rpb4, core protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005329 [exp] 114 / 1e-33 AT5G62950 117 / 1e-34 RNA polymerase II, Rpb4, core protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G067600 [exp] 79 / 3e-19 AT5G62950 144 / 8e-45 RNA polymerase II, Rpb4, core protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0426 [flax] [poplar] HRDC-like PF03874 [flax] [poplar] RNA_pol_Rpb4 RNA polymerase Rpb4
Representative CDS sequence Show only first row Show all	>Lus10039583 pacid=23165221 polypeptide=Lus10039583 locus=Lus10039583.g ID=Lus10039583.BGIv1.0 annot-version=v1.0 ATGCTTAAATCAAGAGGTGCTGCCAAGGAAACCAGAGTAATAGCTCCAGTGGCACCTTCCGAATTCAAGGTGTATGATTATTTGGTGGGGACAGTTGCCT GCAATCAGACTAGAGAACACATCAATGAGTTCCTGAAGAAGAGCAAGAAATATAAGCTTGCAAAATCTGAGATTCTCAATATCATCAACACCAGGCCTTC CCAATTGGTGGAACTTCATCTGCTGATAGAGCAACAAGAAGAAGAGATAGAGCAACAAAGACCAGAGTTAGATATGGAGGAACTATTAGAGCTGATCTTG GAAGTTTTGCCACCCCATCCAATTCAGCCTGAACTAGCTGATGAGGCAGCCAAAGAAACTGAAGAAACTGTTCCGATTGAAGAGGACGAGTAG
AA sequence Show only first row Show all	>Lus10039583 pacid=23165221 polypeptide=Lus10039583 locus=Lus10039583.g ID=Lus10039583.BGIv1.0 annot-version=v1.0 MLKSRGAAKETRVIAPVAPSEFKVYDYLVGTVACNQTREHINEFLKKSKKYKLAKSEILNIINTRPSQLVELHLLIEQQEEEIEQQRPELDMEELLELIL EVLPPHPIQPELADEAAKETEETVPIEEDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62950			RNA polymerase II, Rpb4, core ...		Lus10039583 [exp]	0	1
AT3G54170		ATFIP37	FKBP12 interacting protein 37 ...		Lus10027681 [exp]	1.7	0.9094
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10025933 [exp]	6.9	0.8792
AT3G25940			TFIIB zinc-binding protein (.1...		Lus10015458 [exp]	7.1	0.8910
AT3G23100		XRCC4	homolog of human DNA ligase iv...		Lus10022210 [exp]	8.0	0.8680
AT3G11730		ATFP8, AtRABD1	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10036442 [exp]	8.1	0.8754
AT1G04610		YUC3	YUCCA 3 (.1)		Lus10032609 [exp]	8.5	0.8795
					Lus10015592 [exp]	8.7	0.8768
AT1G59520		CW7	CW7 (.1.2.3)		Lus10012485 [exp]	14.1	0.8581
AT3G62140			unknown protein		Lus10009976 [exp]	14.4	0.8662
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10043279 [exp]	16.4	0.8497

Compare expression of checked genes

Lus10039583 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.