Lus10039584 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039584 pacid=23165314 polypeptide=Lus10039584 locus=Lus10039584.g ID=Lus10039584.BGIv1.0 annot-version=v1.0
ATGGGGAAACTTCGATTGGAAGATGCGAAATCGTCGTCTGTGGAAGGCGGAATTGGCGAAACAGGGTATGGTAGCATTGGCCGTAGTCTCTTGCATGCCG
GAATATCTGGGAATACCAAAGGTTGTTGGTGTCTCCCATTGAATATGAATTTCGGGTGTCTGTTTGAATTTAAAGCGTTTCCAGCAACTGGAACGGGAAG
AGCATCCTCAGAGGATGAAGAGATCAGTTCTGACAAGAACAGTCGCTCCGGTGAGAAGGTGGAAAAGTTGAGAGGAAAAGAAGTCAATAGTTTGCTGAAG
AGTTTCATTCTCTTCATTTCACTACTCATACTTTTAAACACAACTCAACAAAAAAGCATATACAAATCAATTGTGTCCCACCACATCTCCACCCAGTAA
AA sequence
>Lus10039584 pacid=23165314 polypeptide=Lus10039584 locus=Lus10039584.g ID=Lus10039584.BGIv1.0 annot-version=v1.0
MGKLRLEDAKSSSVEGGIGETGYGSIGRSLLHAGISGNTKGCWCLPLNMNFGCLFEFKAFPATGTGRASSEDEEISSDKNSRSGEKVEKLRGKEVNSLLK
SFILFISLLILLNTTQQKSIYKSIVSHHISTQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039584 0 1
AT4G35750 SEC14 cytosolic factor family ... Lus10028388 15.5 0.6688
AT1G73210 Protein of unknown function (D... Lus10038327 27.2 0.6526
AT4G32480 Protein of unknown function (D... Lus10018603 31.9 0.6437
AT1G50370 AtFYPP1 flower- specific, phytochrome-... Lus10041012 43.4 0.6246
AT3G22740 HMT3 homocysteine S-methyltransfera... Lus10006602 103.7 0.5839
AT3G52360 unknown protein Lus10016198 129.0 0.5781
AT1G17100 SOUL heme-binding family prote... Lus10001247 183.2 0.5174
AT2G39445 Phosphatidylinositol N-acetylg... Lus10003796 191.9 0.5274
AT1G16916 unknown protein Lus10024703 205.0 0.5340
AT4G03630 RNI-like superfamily protein (... Lus10008704 272.7 0.5245

Lus10039584 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.