Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52040 120 / 2e-37 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005332 [exp] 114 / 8e-35 AT3G52040 77 / 5e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G262000 [exp] 134 / 9e-43 AT3G52040 118 / 2e-36 unknown protein Potri.009G056800 [exp] 132 / 5e-42 AT3G52040 115 / 2e-35 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039586 pacid=23165095 polypeptide=Lus10039586 locus=Lus10039586.g ID=Lus10039586.BGIv1.0 annot-version=v1.0 ATGACGCAGAAGGCAGCCCTATTCAAAGGGCAACAGAGGAAGAAAACTATACCTCCCAGCCGTCATGGCAAGGCCCCCAAGATTCGCAAAGGTAAGAGAA ACGTGAAGCCATCAAAAACGACTTCGGAGATGGACGCCGATAGAGAACTGACGAAATTCATAAACCGGTGCAATGAGGTGAAAGCAGCCACAATGGCTAA CAAAGAAGGCGGTCAGCTTAGCATTGTTAAGTCAGATCCTGAACCATCGAATTCTGAGAAGAAGTAG
AA sequence Show only first row Show all	>Lus10039586 pacid=23165095 polypeptide=Lus10039586 locus=Lus10039586.g ID=Lus10039586.BGIv1.0 annot-version=v1.0 MTQKAALFKGQQRKKTIPPSRHGKAPKIRKGKRNVKPSKTTSEMDADRELTKFINRCNEVKAATMANKEGGQLSIVKSDPEPSNSEKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52040			unknown protein		Lus10039586 [exp]	0	1
AT3G23390			Zinc-binding ribosomal protein...		Lus10040983 [exp]	1.7	0.9258
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10002027 [exp]	2.8	0.9109
AT5G12410			THUMP domain-containing protei...		Lus10019037 [exp]	5.5	0.8751
AT3G47120	C3HZnF		RNA recognition motif (RRM)-co...		Lus10018227 [exp]	5.7	0.8527
AT3G53740			Ribosomal protein L36e family ...		Lus10016501 [exp]	5.7	0.8886
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10043279 [exp]	6.3	0.8870
AT2G18196			Heavy metal transport/detoxifi...		Lus10010147 [exp]	6.9	0.8674
AT3G25940			TFIIB zinc-binding protein (.1...		Lus10015458 [exp]	7.7	0.8937
AT4G33100			unknown protein		Lus10014752 [exp]	8.5	0.8481
AT3G02080			Ribosomal protein S19e family ...		Lus10020836 [exp]	9.0	0.8661

Compare expression of checked genes

Lus10039586 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.