Lus10039591 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12410 87 / 8e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G48350 78 / 6e-18 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT4G13870 79 / 2e-17 WRNEXO, ATWRNEXO, WEX, ATWEX Werner syndrome-like exonuclease (.1.2)
AT2G36110 73 / 1e-15 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12470 65 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G56310 65 / 2e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12460 63 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12430 57 / 8e-10 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12440 56 / 2e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G62320 52 / 2e-08 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029478 338 / 4e-120 AT5G48350 82 / 2e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029479 188 / 6e-61 AT2G36110 87 / 4e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10039164 141 / 4e-42 AT4G13870 105 / 2e-27 Werner syndrome-like exonuclease (.1.2)
Lus10013769 137 / 3e-40 AT4G13870 105 / 4e-27 Werner syndrome-like exonuclease (.1.2)
Lus10043049 79 / 7e-18 AT2G36110 121 / 4e-34 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10022556 62 / 1e-11 AT4G13870 246 / 1e-80 Werner syndrome-like exonuclease (.1.2)
Lus10010930 59 / 2e-10 AT1G56310 640 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10010357 55 / 4e-09 AT3G11770 66 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036491 54 / 9e-09 AT3G11770 64 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G031400 122 / 7e-35 AT3G12410 101 / 2e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G028700 120 / 6e-34 AT4G13870 104 / 5e-27 Werner syndrome-like exonuclease (.1.2)
Potri.011G116000 113 / 2e-31 AT3G12410 91 / 2e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.017G059200 79 / 2e-17 AT4G13870 288 / 4e-97 Werner syndrome-like exonuclease (.1.2)
Potri.019G021900 64 / 2e-12 AT3G11770 77 / 3e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G028400 56 / 1e-09 ND /
Potri.005G020000 57 / 2e-09 AT1G56310 655 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.013G049000 50 / 1e-07 AT5G06450 / Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G028600 50 / 1e-07 ND /
Potri.001G320201 0 / 1 AT4G13870 0 / 1 Werner syndrome-like exonuclease (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Representative CDS sequence
>Lus10039591 pacid=23165119 polypeptide=Lus10039591 locus=Lus10039591.g ID=Lus10039591.BGIv1.0 annot-version=v1.0
ATGGAGGTTAACTACGTGAGATCGGTCTACTTCGGCGGCTACGAAATCGAAACCACGGTTACCGACCAGGCCTACGCTGTCGAAAACTGGGTTCGATCCT
TCCCGCCTGGTTGGAAGCGGATAGTGGGACTGGACTGCGAGTGGATGCCCTTCTTTTATAACAACCAGGACAACATAACGGCTGTGCTCCAACTCTGCGT
CGAAACCAAGTGCATCATCATACAGATGTCCTACCTCGAATACATCCCCCAGGCCCTGGCCGATTTCCTCGAGAATCCCAATAACTATTTCGCAGGGGTC
GGGGTGGGCGCTGACGTGAGTAGGTTAACAGCAGATTACGGGCTCAGCTGCTCCTCAACTGCTGACATTCAGACCATCGCTAGGGAAGAGTGGAACTGGA
GTAATCTTCCTGGGCTGAAGAATATTTTGCGCCATGTGGAAGGGCTTGTCATGGAGAAACCGCAGCATATTAGGCTGAGCAATTGGCAGAACAGAGATCT
AGACCCCGAGCAGGTTGAGTATGCTTGCATTGATGCTTTTGCTTGTTATAAGATCGGCTACAATCTGCGACGCCGCATCGATGCTTTTATTTACTAG
AA sequence
>Lus10039591 pacid=23165119 polypeptide=Lus10039591 locus=Lus10039591.g ID=Lus10039591.BGIv1.0 annot-version=v1.0
MEVNYVRSVYFGGYEIETTVTDQAYAVENWVRSFPPGWKRIVGLDCEWMPFFYNNQDNITAVLQLCVETKCIIIQMSYLEYIPQALADFLENPNNYFAGV
GVGADVSRLTADYGLSCSSTADIQTIAREEWNWSNLPGLKNILRHVEGLVMEKPQHIRLSNWQNRDLDPEQVEYACIDAFACYKIGYNLRRRIDAFIY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12410 Polynucleotidyl transferase, r... Lus10039591 0 1
AT1G68430 unknown protein Lus10034103 9.8 0.8017
AT1G23820 SPDS1 spermidine synthase 1 (.1.2) Lus10012996 17.4 0.7928
AT4G21500 unknown protein Lus10018431 26.8 0.7485
AT1G60360 RING/U-box superfamily protein... Lus10028063 28.5 0.7741
AT5G35740 Carbohydrate-binding X8 domain... Lus10039059 34.6 0.7716
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10040305 44.7 0.7352
AT1G10380 Putative membrane lipoprotein ... Lus10036687 45.4 0.7686
AT5G20070 ATNUDX19, ATNUD... ARABIDOPSIS THALIANA NUDIX HYD... Lus10014493 56.9 0.7600
AT1G71100 RSW10 RADIAL SWELLING 10, Ribose 5-p... Lus10026777 59.6 0.7650
AT4G05220 Late embryogenesis abundant (L... Lus10006755 63.2 0.7592

Lus10039591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.