Lus10039593 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12560 75 / 1e-15 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
AT3G23880 66 / 1e-12 F-box and associated interaction domains-containing protein (.1)
AT3G10430 65 / 3e-12 F-box and associated interaction domains-containing protein (.1)
AT3G25460 60 / 1e-10 F-box and associated interaction domains-containing protein (.1)
AT3G08750 60 / 1e-10 F-box and associated interaction domains-containing protein (.1)
AT4G04690 60 / 1e-10 F-box and associated interaction domains-containing protein (.1)
AT3G17620 60 / 2e-10 F-box and associated interaction domains-containing protein (.1)
AT1G46984 59 / 2e-10 F-box family protein (.1)
AT3G16210 59 / 2e-10 F-box family protein (.1)
AT4G22390 59 / 3e-10 F-box associated ubiquitination effector family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029527 259 / 8e-86 AT3G07870 70 / 6e-13 F-box and associated interaction domains-containing protein (.1)
Lus10031020 231 / 2e-75 AT3G10430 88 / 3e-19 F-box and associated interaction domains-containing protein (.1)
Lus10026587 96 / 4e-23 AT3G06240 104 / 3e-24 F-box family protein (.1)
Lus10013873 92 / 6e-22 AT3G06240 104 / 2e-24 F-box family protein (.1)
Lus10037892 88 / 2e-20 AT3G06240 107 / 7e-26 F-box family protein (.1)
Lus10038603 88 / 2e-20 AT3G06240 110 / 2e-26 F-box family protein (.1)
Lus10038606 87 / 4e-20 AT3G07870 112 / 1e-27 F-box and associated interaction domains-containing protein (.1)
Lus10023239 84 / 5e-19 AT3G23880 130 / 3e-34 F-box and associated interaction domains-containing protein (.1)
Lus10008870 82 / 4e-18 AT3G23880 126 / 9e-33 F-box and associated interaction domains-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G262900 118 / 1e-31 AT4G12560 107 / 5e-26 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.012G014300 96 / 4e-23 AT3G16210 88 / 6e-19 F-box family protein (.1)
Potri.011G121200 94 / 9e-23 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.006G013000 92 / 5e-22 AT4G12560 250 / 5e-79 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.012G099733 89 / 8e-21 AT3G16210 92 / 2e-20 F-box family protein (.1)
Potri.015G013800 86 / 1e-19 AT4G12560 105 / 7e-25 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.010G207500 84 / 3e-19 AT4G12560 94 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.001G318400 84 / 4e-19 AT3G06240 142 / 3e-38 F-box family protein (.1)
Potri.017G058900 81 / 7e-18 AT3G06240 132 / 2e-34 F-box family protein (.1)
Potri.017G012200 80 / 2e-17 AT4G12560 86 / 4e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10039593 pacid=23165252 polypeptide=Lus10039593 locus=Lus10039593.g ID=Lus10039593.BGIv1.0 annot-version=v1.0
ATGATGAAGCATCTTCCAGAAGATGTGGTGGTACACATCCTAGCCAGGTTGCCTGTCAAAGAAATCCTCAAATGCAGGTCCGTCTGCAAAACCTGGTACT
CTCTCATTTCCACTAAAACCTTCCAATCTTATCACCTCAATCATAATGGGAACCCTAGCCTCATACTTTTCCGCCATGGTATCGGAAAGGATGAAAGAAC
CGAGCATTACTGCTTGTGGGAGGAGTTGGATGCTGATTTCCCTCCTACTCGTCTCCATGAGTTCGATTCTCCCTTCAAATCTGCTGATGCTAAATTTCCG
CTAAAGATTGCTGGTTGTTGCAATGGCCTGGTTTATCTCACTGACGATAACTCCGATTCGAATACCAGAGCAGCTCTTTGGAACCCACAAATCAGGAAAC
TTGTTGAAATTCCTCCTCCAATCGTAACTCTCGACTCAGAGATGATGTGGTGTCTCTGCGCAGTGGGGTTTGGGTTTGATGCTCTGAATGATGACTACAA
GTTGGTGAGAGTCACTTCAAGTGCATACATGGGTCATCAGTCAATTGAGGTTTATTCTTGGAGAAGTGTGTTCTGGAGAATAGTTGAACACCCTTTAAAT
TGTGTTTAG
AA sequence
>Lus10039593 pacid=23165252 polypeptide=Lus10039593 locus=Lus10039593.g ID=Lus10039593.BGIv1.0 annot-version=v1.0
MMKHLPEDVVVHILARLPVKEILKCRSVCKTWYSLISTKTFQSYHLNHNGNPSLILFRHGIGKDERTEHYCLWEELDADFPPTRLHEFDSPFKSADAKFP
LKIAGCCNGLVYLTDDNSDSNTRAALWNPQIRKLVEIPPPIVTLDSEMMWCLCAVGFGFDALNDDYKLVRVTSSAYMGHQSIEVYSWRSVFWRIVEHPLN
CV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10039593 0 1
AT3G54900 ATGRXCP, CXIP1 GLUTAREDOXIN, CAX interacting ... Lus10041501 3.6 0.7672
AT1G23000 Heavy metal transport/detoxifi... Lus10028529 14.2 0.7310
AT2G46810 bHLH bHLH070 basic helix-loop-helix (bHLH) ... Lus10012603 33.6 0.7138
AT5G19370 rhodanese-like domain-containi... Lus10000413 48.4 0.6888
Lus10029097 48.9 0.6913
AT5G13120 Pnsl5, ATCYP20-... Photosynthetic NDH subcomplex... Lus10003138 199.5 0.6294

Lus10039593 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.