Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29850 169 / 2e-56 Eukaryotic protein of unknown function (DUF872) (.1) AT2G19350 167 / 2e-55 Eukaryotic protein of unknown function (DUF872) (.1) AT3G29170 55 / 6e-11 Eukaryotic protein of unknown function (DUF872) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019737 [exp] 176 / 4e-59 AT4G29850 167 / 3e-55 Eukaryotic protein of unknown function (DUF872) (.1) Lus10016385 [exp] 179 / 8e-59 AT4G29850 171 / 2e-55 Eukaryotic protein of unknown function (DUF872) (.1) Lus10007465 [exp] 69 / 2e-16 AT3G29170 125 / 2e-38 Eukaryotic protein of unknown function (DUF872) (.1) Lus10028939 [exp] 37 / 0.0008 AT3G29170 80 / 3e-18 Eukaryotic protein of unknown function (DUF872) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G133500 [exp] 174 / 2e-58 AT4G29850 154 / 3e-50 Eukaryotic protein of unknown function (DUF872) (.1) Potri.006G072000 [exp] 173 / 7e-58 AT4G29850 176 / 6e-59 Eukaryotic protein of unknown function (DUF872) (.1) Potri.006G053300 [exp] 68 / 4e-16 AT3G29170 132 / 3e-41 Eukaryotic protein of unknown function (DUF872) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05915 [flax] [poplar] DUF872 Eukaryotic protein of unknown function (DUF872)
Representative CDS sequence Show only first row Show all	>Lus10039596 pacid=23165241 polypeptide=Lus10039596 locus=Lus10039596.g ID=Lus10039596.BGIv1.0 annot-version=v1.0 ATGGCGTACGTTGACCATGCTTTCTCCATCACCGACGATGACCTAATGATGGACGGATCTTACGCCGCCAGCAACCGTCCTCCCATCAAGGAGATTGGCC TCGCCGTCTCCCTCCTCGTCTTCGGCGTCATCGGAATCGTCCTCGGATTTTATATGACCTCCAACCGAGTCGGCGGCGATAGAGCCCACGGGTTGTTCTT CGTGATATTGGGAGTGGTTCTCTTCATACCGGGATCGTATTACACCAGGCTTGCTTATTATGCATACAAAGGATACAAAGGATTCTCCTTTTCCAACATT CCTCCTGTCTGA
AA sequence Show only first row Show all	>Lus10039596 pacid=23165241 polypeptide=Lus10039596 locus=Lus10039596.g ID=Lus10039596.BGIv1.0 annot-version=v1.0 MAYVDHAFSITDDDLMMDGSYAASNRPPIKEIGLAVSLLVFGVIGIVLGFYMTSNRVGGDRAHGLFFVILGVVLFIPGSYYTRLAYYAYKGYKGFSFSNI PPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29850			Eukaryotic protein of unknown ...		Lus10039596 [exp]	0	1
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Lus10042149 [exp]	5.7	0.8131
AT5G40470			RNI-like superfamily protein (...		Lus10022269 [exp]	14.3	0.8395
AT1G48780			unknown protein		Lus10009004 [exp]	15.2	0.8424
AT1G35830			VQ motif-containing protein (....		Lus10006941 [exp]	17.2	0.8581
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10029452 [exp]	18.9	0.8466
AT1G25280	TUB	AtTLP10	tubby like protein 10 (.1.2.3)		Lus10028579 [exp]	22.8	0.8427
AT3G27960			Tetratricopeptide repeat (TPR)...		Lus10008786 [exp]	28.4	0.8233
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10007457 [exp]	29.6	0.8034
AT5G50160		ATFRO8, FRO8	ferric reduction oxidase 8 (.1...		Lus10019488 [exp]	31.1	0.8170
AT3G53010			Domain of unknown function (DU...		Lus10001129 [exp]	34.5	0.8254

Compare expression of checked genes

Lus10039596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.