Lus10039608 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029516 111 / 1e-31 AT1G07985 69 / 3e-15 Expressed protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G266500 42 / 2e-05 AT1G07985 73 / 3e-17 Expressed protein (.1)
PFAM info
Representative CDS sequence
>Lus10039608 pacid=23165344 polypeptide=Lus10039608 locus=Lus10039608.g ID=Lus10039608.BGIv1.0 annot-version=v1.0
ATGATGAGGCAGCTGGAGGAGATAAGGGGGAGCCGTAGGTGGTCTTCCAAGAGCTCTCCGAGGTCATACCCGTCAACTCCGACGAGTGCGACCACAGGAG
GGAGCCATGCGACGTCGTTTACTACGGACAATACACCATCGTCGCCAAAGAGTATGGAGAAACGGTGTCGTCCGCTGGAGAGCGTTATGGCCGAGGTTGG
GATGAAAGGAAACCTCATCGACCGTCTTCACTTTGTCGAGGACCGCATGCTTAAGATGGAGGATGAGCTAGAGGAGGATAGGAAGAAATTAGATGGTAAC
GATCAGGAGTGTGTGACTAGTCCGAGGTCTTCAGAGAAGAAGAAAGGGTTGAAAGGACTGGTTCGCAAGATAATCCATCCACATCATCATCACCACCACC
ATAACGATCACCACCACCATGGTAATAGCAGTCCAAGTCATCGAGACAGCTTGTCATGA
AA sequence
>Lus10039608 pacid=23165344 polypeptide=Lus10039608 locus=Lus10039608.g ID=Lus10039608.BGIv1.0 annot-version=v1.0
MMRQLEEIRGSRRWSSKSSPRSYPSTPTSATTGGSHATSFTTDNTPSSPKSMEKRCRPLESVMAEVGMKGNLIDRLHFVEDRMLKMEDELEEDRKKLDGN
DQECVTSPRSSEKKKGLKGLVRKIIHPHHHHHHHNDHHHHGNSSPSHRDSLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039608 0 1
AT4G17250 unknown protein Lus10000731 2.0 0.8120
AT4G28240 Wound-responsive family protei... Lus10033728 5.8 0.7904
AT2G29670 Tetratricopeptide repeat (TPR)... Lus10018221 11.3 0.7416
AT3G43660 Vacuolar iron transporter (VIT... Lus10035086 20.4 0.7746
AT3G07870 F-box and associated interacti... Lus10006403 25.1 0.7770
AT4G37420 Domain of unknown function (DU... Lus10016022 30.9 0.7353
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10016317 33.2 0.7264
AT1G12855 F-box family protein (.1) Lus10042738 43.3 0.7579
AT1G71340 AtGDPD4 glycerophosphodiester phosphod... Lus10013777 45.7 0.7516
AT3G27820 ATMDAR4 monodehydroascorbate reductase... Lus10022260 53.0 0.7166

Lus10039608 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.