Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02120 65 / 5e-16 PDF2.1, LCR70 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) AT2G02100 65 / 5e-16 LCR69, PDF2.2 low-molecular-weight cysteine-rich 69 (.1) AT2G02130 62 / 1e-14 PDF2.3, LCR68 low-molecular-weight cysteine-rich 68 (.1) AT1G61070 59 / 9e-14 LCR66, PDF2.4 PLANT DEFENSIN 2.4, low-molecular-weight cysteine-rich 66 (.1) AT5G63660 54 / 9e-12 LCR74, PDF2.5 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) AT2G31957 46 / 1e-08 LCR75, LCR79 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 79, low-molecular-weight cysteine-rich 75 (.1) AT2G02140 46 / 1e-08 LCR72, PDF2.6 low-molecular-weight cysteine-rich 72 (.1) AT2G31953 40 / 3e-06 LCR76 low-molecular-weight cysteine-rich 76 (.1) AT2G02147 34 / 0.0006 LCR73 low-molecular-weight cysteine-rich 73 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029546 [exp] 105 / 7e-32 AT2G02120 65 / 1e-15 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10000290 [exp] 103 / 2e-31 AT2G02120 67 / 2e-16 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10019226 [exp] 61 / 3e-14 AT2G02120 81 / 6e-22 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10004290 [exp] 60 / 6e-14 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1) Lus10004289 [exp] 59 / 1e-13 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1) Lus10029544 [exp] 56 / 4e-12 AT2G02130 87 / 4e-24 low-molecular-weight cysteine-rich 68 (.1) Lus10019227 [exp] 47 / 9e-09 AT2G02130 66 / 1e-15 low-molecular-weight cysteine-rich 68 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T011201 [exp] 61 / 2e-14 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1) Potri.T011200 [exp] 61 / 2e-14 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1) Potri.T011301 [exp] 57 / 4e-13 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.T011300 [exp] 57 / 4e-13 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.004G138100 [exp] 52 / 9e-11 AT5G63660 71 / 4e-18 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF00304 [flax] [poplar] Gamma-thionin Gamma-thionin family
Representative CDS sequence Show only first row Show all	>Lus10039622 pacid=23165031 polypeptide=Lus10039622 locus=Lus10039622.g ID=Lus10039622.BGIv1.0 annot-version=v1.0 ATGGGTGATGCTACCGGAGCAAGAAGATGTGAGTATGAAAGCAGGAGATTCAAAGGTACATGTGAGGTAGACAAAAATTGTGCCGATGTTTGCAAGCTCG AAGGCTTCCCCGGAGGTGATTGCCAGGGCTTCCGCACCGGTTGCTACTGCACCAGGCCTTGCTAA
AA sequence Show only first row Show all	>Lus10039622 pacid=23165031 polypeptide=Lus10039622 locus=Lus10039622.g ID=Lus10039622.BGIv1.0 annot-version=v1.0 MGDATGARRCEYESRRFKGTCEVDKNCADVCKLEGFPGGDCQGFRTGCYCTRPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02120		PDF2.1, LCR70	LOW-MOLECULAR-WEIGHT CYSTEINE-...		Lus10039622 [exp]	0	1
AT2G37880			Protein of unknown function, D...		Lus10021495 [exp]	7.1	0.8255
AT4G03230			S-locus lectin protein kinase ...		Lus10033752 [exp]	10.0	0.7655
AT5G57820			zinc ion binding (.1)		Lus10007703 [exp]	11.5	0.7916
AT4G29250			HXXXD-type acyl-transferase fa...		Lus10028335 [exp]	12.4	0.8081
AT1G13890		ATSNAP30, SNAP3...	soluble N-ethylmaleimide-sensi...		Lus10037092 [exp]	12.6	0.7166
AT1G05070			Protein of unknown function (D...		Lus10015556 [exp]	13.2	0.6369
AT4G30200		VEL1, VIL2	VIN3-Like 2, vernalization5/VI...		Lus10040339 [exp]	14.7	0.7578
AT4G28040			nodulin MtN21 /EamA-like trans...		Lus10015498 [exp]	16.4	0.6512
AT4G19170		CCD4, NCED4	carotenoid cleavage dioxygenas...		Lus10035700 [exp]	18.7	0.7907
AT1G60170		EMB1220	embryo defective 1220, pre-mRN...		Lus10002830 [exp]	22.4	0.7226

Compare expression of checked genes

Lus10039622 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.