Lus10039628 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14890 40 / 0.0002 NHL domain-containing protein (.1)
AT5G65610 39 / 0.0005 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001932 44 / 6e-06 AT5G14890 76 / 1e-17 NHL domain-containing protein (.1)
Lus10001933 44 / 7e-06 AT5G14890 78 / 4e-17 NHL domain-containing protein (.1)
Lus10001942 43 / 8e-06 AT5G14890 79 / 1e-17 NHL domain-containing protein (.1)
Lus10033413 38 / 0.001 AT5G14890 96 / 3e-23 NHL domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G000801 37 / 0.0003 ND /
PFAM info
Representative CDS sequence
>Lus10039628 pacid=23165042 polypeptide=Lus10039628 locus=Lus10039628.g ID=Lus10039628.BGIv1.0 annot-version=v1.0
ATGGAAGTCGGCGGCGACTGCAATCCAGCTTCCCCACACCCTCACCGGCGACGGTCCTTCCACTTCCTGGCAGCCAGAACCGGGTGCATGACTATGATGG
CGTCACCGACATCTATCCACGAGGAAATGCAGTACACTCGCCTTGAATACTGCGACGACGCCAGATCCAGGTCATCAATTACAGCTGACCGGCGGAGATC
ATCGACAGTAGGAGGGCCGAGGATGTGGAGCAAGTTTATAAAGAGGTTAGTGAAGGATGGGAAGATCAGCAGGATATGCGGATCATCAACCACCAGCACC
AAACGGTTGTCGTTTCATTACGATGCTCTCAGCTATTCCCAGAATTTCGATGATGGCAGCTGGGTTTCATGA
AA sequence
>Lus10039628 pacid=23165042 polypeptide=Lus10039628 locus=Lus10039628.g ID=Lus10039628.BGIv1.0 annot-version=v1.0
MEVGGDCNPASPHPHRRRSFHFLAARTGCMTMMASPTSIHEEMQYTRLEYCDDARSRSSITADRRRSSTVGGPRMWSKFIKRLVKDGKISRICGSSTTST
KRLSFHYDALSYSQNFDDGSWVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039628 0 1
AT5G06760 AtLEA4-5, LEA4-... Late Embryogenesis Abundant 4-... Lus10012018 1.7 0.8586
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10039094 6.3 0.8349
AT5G25140 CYP71B13 "cytochrome P450, family 71, s... Lus10038158 6.5 0.8575
AT5G37020 ARF ARF8, ATARF8 auxin response factor 8 (.1.2) Lus10020805 17.9 0.7969
AT3G06120 bHLH MUTE, bHLH045 MUTE, basic helix-loop-helix (... Lus10034031 17.9 0.8407
AT3G23255 unknown protein Lus10011825 19.3 0.8213
AT3G63520 ATNCED1, ATCCD1... carotenoid cleavage dioxygenas... Lus10042829 22.1 0.8145
AT5G52970 thylakoid lumen 15.0 kDa prote... Lus10001399 22.6 0.8134
AT5G10770 Eukaryotic aspartyl protease f... Lus10026243 23.9 0.7896
AT5G22410 RHS18 root hair specific 18 (.1) Lus10032511 25.3 0.7458

Lus10039628 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.