Lus10039643 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65730 464 / 9e-167 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT4G37800 459 / 1e-164 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT5G13870 308 / 4e-105 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT2G06850 298 / 4e-101 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT4G03210 283 / 2e-95 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT5G57530 276 / 1e-92 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT4G14130 274 / 6e-92 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 273 / 2e-91 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT1G11545 273 / 2e-91 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
AT4G25820 272 / 5e-91 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011597 564 / 0 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10040121 305 / 6e-104 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10030923 305 / 7e-104 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10003022 304 / 2e-103 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10011052 303 / 2e-102 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10039715 295 / 4e-100 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10018503 295 / 8e-100 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10035654 290 / 6e-98 AT2G14620 437 / 6e-156 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Lus10031586 283 / 4e-95 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G008500 489 / 1e-176 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.014G140300 309 / 1e-105 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.001G071000 307 / 8e-105 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.003G159700 306 / 4e-104 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.009G083800 291 / 1e-98 AT2G14620 454 / 1e-162 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Potri.014G146100 285 / 4e-96 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201200 282 / 5e-95 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G244200 281 / 1e-94 AT4G13090 321 / 3e-110 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Potri.011G077320 281 / 1e-94 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201250 281 / 2e-94 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10039643 pacid=23165171 polypeptide=Lus10039643 locus=Lus10039643.g ID=Lus10039643.BGIv1.0 annot-version=v1.0
ATGAGCACAAGTAGTGCCGTAATTTGCATTGCTGTTGTTATTGTAGTGGCTTTTGCTTCTGCTCCCAAATTAGTCTCTTCCCGCCCCACTACTTTCTTGC
AGGACTTCAAGGTCACCTGGGGTGATTCCCACGTCCGACAACTTGACGGCGGCCGAGCCATTCAGCTCCTCCTCGACCAAAACTCAGGATGTGGGTTTGC
TTCGAAGAGGAAGTACTTGTTCGGACAGGTCAGCATGAGGATCAAGCTCGTCCCTGGAGATTCCGCTGGAACCGTCACTGCTTTCTATCTGAACTCGGAC
ACCAACGAAATTAGAGATGAGCTGGACTTCGAGTTTCTGGGGAACCGAAGCGGGCAGCCTTACACGGTTCAAACCAACATATTTGCCCACGGAAAGGGAG
ACAAAGAACAAAGAGTCAACCTCTGGTTCGACCCATCTGCCGACTTCCACCTCTACCGTATCCGCTGGAGCCACTCCCAGATTGTGTATTACGTAGATGA
TGTGCCAGTGAGGGTATTCAAGAACAACGAAGCGAAAGGAGTGGGGTACCCAAAGTCACAGCCAATGGGAGTGTACTCGACGTTGTGGGAGGCAGATGAC
TGGGCAACGAGAGGAGGATTGGAGAAGATTAATTGGAGCAAAGCTCCATTCATGGCCTACTACAAGGACTTTGATATTGAAGGTTGTCCAGTCCCAGGAC
CCTCCACTTGTGCTTCCAACCCTAGTAATTGGTGGGAAGGCGCAAATTACAAAGGACTCACTCCACTTGAAGCTAGGAAATACAGGTGGGTTCGTATGAA
CCACATGATCTACGACTATTGCACCGACAAATCCCGCTTCCCCGTCCCTCCCACCGAGTGTACCGCCGGCATCCTCTGA
AA sequence
>Lus10039643 pacid=23165171 polypeptide=Lus10039643 locus=Lus10039643.g ID=Lus10039643.BGIv1.0 annot-version=v1.0
MSTSSAVICIAVVIVVAFASAPKLVSSRPTTFLQDFKVTWGDSHVRQLDGGRAIQLLLDQNSGCGFASKRKYLFGQVSMRIKLVPGDSAGTVTAFYLNSD
TNEIRDELDFEFLGNRSGQPYTVQTNIFAHGKGDKEQRVNLWFDPSADFHLYRIRWSHSQIVYYVDDVPVRVFKNNEAKGVGYPKSQPMGVYSTLWEADD
WATRGGLEKINWSKAPFMAYYKDFDIEGCPVPGPSTCASNPSNWWEGANYKGLTPLEARKYRWVRMNHMIYDYCTDKSRFPVPPTECTAGIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G65730 XTH6, XTR10 xyloglucan endotransglucosylas... Lus10039643 0 1
AT5G65730 XTH6, XTR10 xyloglucan endotransglucosylas... Lus10011597 1.4 0.9569
AT1G75900 EXL3 GDSL-like Lipase/Acylhydrolase... Lus10028425 1.7 0.9332
AT1G78955 CAMS1 camelliol C synthase 1 (.1) Lus10016441 2.0 0.9582
AT4G12300 CYP706A4 "cytochrome P450, family 706, ... Lus10032213 3.0 0.9168
Lus10016100 3.2 0.9269
AT4G34810 SAUR-like auxin-responsive pro... Lus10042379 3.6 0.9022
AT1G12480 SLAC1, RCD3, CD... SLOW ANION CHANNEL-ASSOCIATED ... Lus10006678 4.2 0.9251
AT5G25840 Protein of unknown function (D... Lus10011427 4.6 0.9212
AT1G79600 Protein kinase superfamily pro... Lus10035701 4.9 0.8696
AT1G78955 CAMS1 camelliol C synthase 1 (.1) Lus10016442 5.7 0.8910

Lus10039643 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.