Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65880 35 / 0.0002 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011719 [exp] 41 / 5e-06 AT5G65880 39 / 6e-05 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G006700 [exp] 42 / 5e-07 AT5G65880 / unknown protein Potri.014G006850 [exp] 35 / 0.0002 AT5G65880 49 / 7e-10 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039652 pacid=23165162 polypeptide=Lus10039652 locus=Lus10039652.g ID=Lus10039652.BGIv1.0 annot-version=v1.0 ATGTTCCTCAGGAGGAGCCGGTTCCTCTCATTCCCTTTGGTAATTGGAGCTGTTATTGTTGGAGTCATTTCTGGGAAGGCTTTGTTTGGGCAACCACTTG ATGATTACTGGAAAAAGAAGCTCCAGGAAGAAGCAGCTGCAAAAGAGACTGATGCAAAGAACTCAACAAGCTAA
AA sequence Show only first row Show all	>Lus10039652 pacid=23165162 polypeptide=Lus10039652 locus=Lus10039652.g ID=Lus10039652.BGIv1.0 annot-version=v1.0 MFLRRSRFLSFPLVIGAVIVGVISGKALFGQPLDDYWKKKLQEEAAAKETDAKNSTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G65880			unknown protein		Lus10039652 [exp]	0	1
AT5G18100		CSD3	copper/zinc superoxide dismuta...		Lus10010651 [exp]	1.4	0.8966
AT4G37020			unknown protein		Lus10000435 [exp]	3.5	0.8817
AT1G32310			unknown protein		Lus10040092 [exp]	5.1	0.8410
AT1G16670			Protein kinase superfamily pro...		Lus10028149 [exp]	5.7	0.8804
AT4G08690			Sec14p-like phosphatidylinosit...		Lus10020911 [exp]	6.3	0.8905
AT5G60335			Thioesterase superfamily prote...		Lus10028483 [exp]	8.7	0.8514
AT5G25800			Polynucleotidyl transferase, r...		Lus10018935 [exp]	9.2	0.8548
AT4G16770			2-oxoglutarate (2OG) and Fe(II...		Lus10007820 [exp]	10.2	0.8456
AT2G28230			TATA-binding related factor (T...		Lus10030654 [exp]	10.2	0.8665
AT4G14420			HR-like lesion-inducing protei...		Lus10041149 [exp]	10.4	0.8683

Compare expression of checked genes

Lus10039652 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.