Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027187 [exp] 109 / 3e-33 AT3G48180 43 / 5e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G153900 [exp] 45 / 8e-08 AT1G19020 40 / 1e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039655 pacid=23165372 polypeptide=Lus10039655 locus=Lus10039655.g ID=Lus10039655.BGIv1.0 annot-version=v1.0 ATGGCGAGCAAAACGTTGAGCTGGTCGGAGCGGGGGGGTAGCTACGAGATGCAGGATAGAGATGACGATGATCTAGCGACATCGGAGAAGAAAGGAAAGA AGATGGCGGATGTAAAATCAGCAGCATCGGCCGGACTGGACAAGGCTAAGTCTGCAGCGACTGCTGGTGCGTCTAAGATGAAGAGTGGGACTTCTGTTGG GATCAAGTGGGTGAAGAAACAGTGCCGCAAGAAGTTCTCTTCTTGA
AA sequence Show only first row Show all	>Lus10039655 pacid=23165372 polypeptide=Lus10039655 locus=Lus10039655.g ID=Lus10039655.BGIv1.0 annot-version=v1.0 MASKTLSWSERGGSYEMQDRDDDDLATSEKKGKKMADVKSAASAGLDKAKSAATAGASKMKSGTSVGIKWVKKQCRKKFSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039655 [exp]	0	1
AT5G62650			Tic22-like family protein (.1)		Lus10010502 [exp]	6.9	0.6670
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10018381 [exp]	14.3	0.6865
AT5G16610			unknown protein		Lus10031615 [exp]	19.0	0.6312
AT4G10270			Wound-responsive family protei...		Lus10031616 [exp]	19.6	0.6902
AT4G11650		ATOSM34	osmotin 34 (.1)		Lus10017170 [exp]	33.8	0.6540
AT5G10695			unknown protein		Lus10042440 [exp]	35.4	0.6656
AT5G17680			disease resistance protein (TI...		Lus10010223 [exp]	40.4	0.6634
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10037323 [exp]	46.4	0.6288
AT4G34660			SH3 domain-containing protein ...		Lus10028785 [exp]	51.3	0.5835
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10039344 [exp]	52.0	0.6578

Compare expression of checked genes

Lus10039655 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.