Lus10039656 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G05630 179 / 1e-58 ATG8D Ubiquitin-like superfamily protein (.1.2)
AT1G62040 178 / 9e-58 ATG8C autophagy 8c, Ubiquitin-like superfamily protein (.1.2)
AT4G21980 171 / 4e-55 ATG8A, APG8A AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2)
AT4G04620 169 / 2e-54 ATG8B autophagy 8b, Ubiquitin-like superfamily protein (.1.2)
AT3G60640 164 / 2e-52 ATG8G AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1)
AT4G16520 162 / 7e-52 ATG8F autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
AT2G45170 160 / 7e-51 ATATG8E AUTOPHAGY 8E (.1.2)
AT3G15580 126 / 1e-37 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
AT3G06420 123 / 3e-36 ATG8H autophagy 8h, Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027186 192 / 2e-63 AT2G05630 222 / 1e-76 Ubiquitin-like superfamily protein (.1.2)
Lus10015563 177 / 2e-57 AT1G62040 230 / 1e-79 autophagy 8c, Ubiquitin-like superfamily protein (.1.2)
Lus10004352 165 / 1e-52 AT2G45170 203 / 1e-68 AUTOPHAGY 8E (.1.2)
Lus10028933 164 / 2e-52 AT4G16520 215 / 6e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Lus10008507 163 / 5e-52 AT4G16520 216 / 3e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Lus10000733 162 / 1e-51 AT4G16520 217 / 1e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Lus10038046 130 / 5e-39 AT3G15580 199 / 1e-67 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
Lus10009987 119 / 6e-31 AT3G62240 625 / 0.0 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G228800 185 / 1e-60 AT2G05630 224 / 1e-77 Ubiquitin-like superfamily protein (.1.2)
Potri.014G153800 184 / 2e-60 AT2G05630 202 / 6e-69 Ubiquitin-like superfamily protein (.1.2)
Potri.004G013700 176 / 6e-57 AT1G62040 216 / 3e-74 autophagy 8c, Ubiquitin-like superfamily protein (.1.2)
Potri.011G004300 172 / 3e-55 AT4G21980 219 / 1e-74 AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2)
Potri.002G144600 166 / 2e-53 AT3G60640 192 / 8e-65 AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1)
Potri.003G110901 166 / 3e-53 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Potri.008G136040 166 / 3e-53 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Potri.001G122700 166 / 4e-53 AT4G16520 191 / 2e-64 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Potri.014G060300 159 / 2e-50 AT4G16520 214 / 1e-73 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Potri.008G099400 132 / 7e-40 AT3G15580 187 / 7e-63 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Representative CDS sequence
>Lus10039656 pacid=23165130 polypeptide=Lus10039656 locus=Lus10039656.g ID=Lus10039656.BGIv1.0 annot-version=v1.0
ATGGTCCAGAGCTCCTTCAAGCTGGAACATCCCCTCGAGAGGAGGCAGGCTGAAGCTGCTCGCATTAGGGAGAAATATCCAGACAGAATCCCAGTGATTG
TTGAGAAGGCTGAAAAGAGTGACGTGCCCGACATTGACAAGAAGAAATACTTGGCTCCTGCTGATCTCACGGTTGGCCAATTCGTGTACGTGGTCCGGAA
AAGGATCAAGCTGAGTCCCGAGAAAGCCATCTTCATTTTCGTCAAGAACATTCTACCTCCCACCGAGAGGAGGCAGGCTGAAGCTGCTCGCATTAGGGAA
AAGTATCCCGGCAGGATCCCGGTTATTGTTGAGAGGGCTGAAAAGAGTGATGTGCCGGACATTGACAAGAAGAAATATCTGGTTCCTGCTGATCTCACCG
TGGGTCAGTTCGTCTATGTGGTTCGTAAGAGGATCAAGCTGACTCCCGAAAAGGCCATTTTCATTTTTGTCAAGAACATCTTACCACCCACCGCTGCTAT
GATGGCCGCCATTTACGAAGAGAACAAGGACGAGGATGGCTTCCTTTACATGACCTACAGCGGGGAGAACACCTTTGGAAAAGACCTCTGA
AA sequence
>Lus10039656 pacid=23165130 polypeptide=Lus10039656 locus=Lus10039656.g ID=Lus10039656.BGIv1.0 annot-version=v1.0
MVQSSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAEKSDVPDIDKKKYLAPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTERRQAEAARIRE
KYPGRIPVIVERAEKSDVPDIDKKKYLVPADLTVGQFVYVVRKRIKLTPEKAIFIFVKNILPPTAAMMAAIYEENKDEDGFLYMTYSGENTFGKDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G05630 ATG8D Ubiquitin-like superfamily pro... Lus10039656 0 1
AT1G04760 ATVAMP726 vesicle-associated membrane pr... Lus10025933 1.7 0.9222
AT3G13200 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 /... Lus10022566 3.9 0.9051
AT3G25940 TFIIB zinc-binding protein (.1... Lus10015458 4.0 0.9113
AT1G15910 FDM1 factor of DNA methylation 1, X... Lus10036870 4.5 0.8976
Lus10015592 5.9 0.8942
AT5G19490 CCAAT Histone superfamily protein (.... Lus10026780 7.5 0.8687
AT4G08240 unknown protein Lus10009881 9.2 0.9033
AT2G29540 ATRPAC14, ATRPC... RNApolymerase 14 kDa subunit (... Lus10040717 10.2 0.8661
AT4G13520 SMAP1 small acidic protein 1 (.1) Lus10004400 10.5 0.8442
Lus10011965 11.0 0.8625

Lus10039656 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.