Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32360 48 / 6e-08 Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027183 [exp] 140 / 9e-45 AT2G32360 66 / 9e-15 Ubiquitin-like superfamily protein (.1) Lus10015125 [exp] 86 / 2e-23 AT2G32360 61 / 1e-12 Ubiquitin-like superfamily protein (.1) Lus10031549 [exp] 85 / 2e-21 AT3G05870 158 / 6e-50 anaphase-promoting complex/cyclosome 11 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G122500 [exp] 88 / 2e-24 AT2G32360 66 / 2e-14 Ubiquitin-like superfamily protein (.1) Potri.017G037500 [exp] 87 / 4e-24 AT2G32360 67 / 2e-15 Ubiquitin-like superfamily protein (.1) Potri.017G037400 [exp] 0 / 1 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Lus10039658 pacid=23165338 polypeptide=Lus10039658 locus=Lus10039658.g ID=Lus10039658.BGIv1.0 annot-version=v1.0 ATGATGGTGGTGGTGGAGATATTGACAGGGAGCCTCTTCCCTGTCCATGTAGGAGAAGATGCCACTGTTGGCGATCTTAAGCAAGAAATCGAATCGCAGC AGAAGCTACCTGTCAATCGCATGATACTCCTGCTCGGTGATGATCGTTTAGACGACGATGATGATTTGCTTCTTTCTGAATGTAGAGTTCAAGACGGCTC CCATGTGTATCTGTTCTTCAATCCTTTAGATGATGGCTCTTCTCATAGCTTCGTTTTCGCTAGGCCGGAGGCCTCTTCTTGA
AA sequence Show only first row Show all	>Lus10039658 pacid=23165338 polypeptide=Lus10039658 locus=Lus10039658.g ID=Lus10039658.BGIv1.0 annot-version=v1.0 MMVVVEILTGSLFPVHVGEDATVGDLKQEIESQQKLPVNRMILLLGDDRLDDDDDLLLSECRVQDGSHVYLFFNPLDDGSSHSFVFARPEASS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G32360			Ubiquitin-like superfamily pro...		Lus10039658 [exp]	0	1
AT1G80600		WIN1	HOPW1-1-interacting 1 (.1)		Lus10008025 [exp]	32.8	0.5945
AT5G53840			F-box/RNI-like/FBD-like domain...		Lus10014161 [exp]	35.7	0.5487
					Lus10017053 [exp]	38.8	0.4745
AT3G11080		AtRLP35	receptor like protein 35 (.1)		Lus10004307 [exp]	39.9	0.6006
AT2G35615			Eukaryotic aspartyl protease f...		Lus10035668 [exp]	41.7	0.5878
AT1G12064			unknown protein		Lus10010487 [exp]	42.4	0.5845
					Lus10000293 [exp]	44.7	0.5430
AT1G24420			HXXXD-type acyl-transferase fa...		Lus10033658 [exp]	51.1	0.5907
					Lus10022857 [exp]	69.5	0.5104
AT5G07630			lipid transporters (.1)		Lus10027222 [exp]	110.1	0.4925

Compare expression of checked genes

Lus10039658 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.