Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) AT5G54760 215 / 5e-74 Translation initiation factor SUI1 family protein (.1.2.3) AT1G54290 211 / 1e-72 Translation initiation factor SUI1 family protein (.1) AT5G54940 172 / 5e-57 Translation initiation factor SUI1 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027181 [exp] 233 / 5e-81 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10015124 [exp] 214 / 1e-73 AT4G27130 209 / 8e-72 Translation initiation factor SUI1 family protein (.1) Lus10031550 [exp] 209 / 5e-71 AT4G27130 207 / 2e-70 Translation initiation factor SUI1 family protein (.1) Lus10021532 [exp] 159 / 5e-52 AT5G54940 169 / 9e-56 Translation initiation factor SUI1 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G134700 [exp] 220 / 6e-76 AT4G27130 213 / 3e-73 Translation initiation factor SUI1 family protein (.1) Potri.007G122700 [exp] 219 / 6e-76 AT4G27130 217 / 5e-75 Translation initiation factor SUI1 family protein (.1) Potri.007G122600 [exp] 218 / 3e-75 AT4G27130 215 / 3e-74 Translation initiation factor SUI1 family protein (.1) Potri.001G418600 [exp] 215 / 3e-74 AT1G54290 218 / 2e-75 Translation initiation factor SUI1 family protein (.1) Potri.017G037100 [exp] 188 / 9e-64 AT1G54290 187 / 2e-63 Translation initiation factor SUI1 family protein (.1) Potri.010G151700 [exp] 161 / 6e-53 AT5G54940 170 / 2e-56 Translation initiation factor SUI1 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01253 [flax] [poplar] SUI1 Translation initiation factor SUI1
Representative CDS sequence Show only first row Show all	>Lus10039660 pacid=23165287 polypeptide=Lus10039660 locus=Lus10039660.g ID=Lus10039660.BGIv1.0 annot-version=v1.0 ATGTCTGAGTTCGACAGCCAGATTCCATCTGCTTTTGATCCTTTTGCTGATGCAAATGCTGAGGACTCTGGCGCTGGTGGGAAAGAGTACGTTCATGTAC GCATACAGCAGCGTAATGGTAGGAAGAGCCTGACGACTGTTCAAGGTTTGAAGAAAGACTTTAGCTACAACAAGATTCTCAAGGACTTGAAGAAGGAGTT CTGCTGTAATGGTACAGTTGTCCAGGACCCTGAGTTAGGCCAGGTTATTCAACTACAGGGTGATCAGAGGAAGAACGTCTCCACCTTCCTTGTGCAGGCT GGGATTGTGAAGAAGGAGAACATCAAGATCCATGGTTTTTAA
AA sequence Show only first row Show all	>Lus10039660 pacid=23165287 polypeptide=Lus10039660 locus=Lus10039660.g ID=Lus10039660.BGIv1.0 annot-version=v1.0 MSEFDSQIPSAFDPFADANAEDSGAGGKEYVHVRIQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA GIVKKENIKIHGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27130			Translation initiation factor ...		Lus10039660 [exp]	0	1
AT4G15940			Fumarylacetoacetate (FAA) hydr...		Lus10006496 [exp]	2.4	0.9356
AT1G68300			Adenine nucleotide alpha hydro...		Lus10041436 [exp]	4.2	0.9405
AT3G29010			Biotin/lipoate A/B protein lig...		Lus10003218 [exp]	5.1	0.9135
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10022904 [exp]	7.5	0.9127
AT1G17130			Family of unknown function (DU...		Lus10005575 [exp]	8.7	0.9172
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10004692 [exp]	9.0	0.9127
AT4G27130			Translation initiation factor ...		Lus10027181 [exp]	10.4	0.9290
AT2G32090			Lactoylglutathione lyase / gly...		Lus10010552 [exp]	10.4	0.9185
AT3G61200			Thioesterase superfamily prote...		Lus10018847 [exp]	11.2	0.9075
AT5G23590			DNAJ heat shock N-terminal dom...		Lus10027828 [exp]	14.5	0.9124

Compare expression of checked genes

Lus10039660 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.