Lus10039661 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17880 213 / 7e-72 ATBTF3 basic transcription factor 3 (.1)
AT1G73230 200 / 1e-66 Nascent polypeptide-associated complex NAC (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031551 237 / 2e-81 AT1G17880 255 / 2e-88 basic transcription factor 3 (.1)
Lus10015123 236 / 4e-81 AT1G17880 253 / 1e-87 basic transcription factor 3 (.1)
Lus10027180 214 / 3e-72 AT1G17880 238 / 1e-81 basic transcription factor 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G078300 226 / 7e-77 AT1G73230 197 / 2e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.017G141100 222 / 2e-75 AT1G73230 196 / 3e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.015G029800 184 / 3e-60 AT1G17880 232 / 4e-79 basic transcription factor 3 (.1)
Potri.012G037900 182 / 9e-60 AT1G73230 225 / 1e-76 Nascent polypeptide-associated complex NAC (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Lus10039661 pacid=23165202 polypeptide=Lus10039661 locus=Lus10039661.g ID=Lus10039661.BGIv1.0 annot-version=v1.0
ATGAATCGGGAGAGGCTGATGAAGATGGCCGGTTCTGTTCGCACCGGCGGGAAGGGAACCGTACGCAGAAAGAAGAAGGCGGTGCACAAATCGACCACCA
CAGACGACAAGAAGCTTCAGGGCACACTGAAGAGGATTGGAGTCAACACTATCCCCGCCATTGAGGAGGTCAACATCTTCAAGGATGATTTGGTGATTCA
GTTTGTTAACCCGAAAGTTCAGGCTTCAATTGCTGCCAACACTTGGGTCATCACTGGTTCTCCTCAAACCAGAAAGTTGCAAGATATTCTTCCAGGAATC
ATCAACCAGCTTGGACCCGATAACTTGGACAACCTGAAGAAGTTGGCTGAGCAGTTCCAGAAGGAGGCTCCAGCTGGTGGTGCAATCCAAGAAGAAGACG
ATGATGATGTACCGGAGCTTGTAGCTGGGGAGACATTTGAAGCAGCAGCTGCGGAAGAGACTCGTGCTTAA
AA sequence
>Lus10039661 pacid=23165202 polypeptide=Lus10039661 locus=Lus10039661.g ID=Lus10039661.BGIv1.0 annot-version=v1.0
MNRERLMKMAGSVRTGGKGTVRRKKKAVHKSTTTDDKKLQGTLKRIGVNTIPAIEEVNIFKDDLVIQFVNPKVQASIAANTWVITGSPQTRKLQDILPGI
INQLGPDNLDNLKKLAEQFQKEAPAGGAIQEEDDDDVPELVAGETFEAAAAEETRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10039661 0 1
AT1G13380 Protein of unknown function (D... Lus10041447 4.1 0.8136
AT1G32330 HSF ATHSFA1D heat shock transcription facto... Lus10030956 6.6 0.7868
AT5G59500 protein C-terminal S-isoprenyl... Lus10001571 7.7 0.8302
AT4G14700 ORC1, ATORC1A, ... origin recognition complex 1 (... Lus10031848 7.7 0.8153
AT5G36120 atylmg3, CCB3 "cofactor assembly, complex C ... Lus10013424 9.4 0.8432
AT4G23820 Pectin lyase-like superfamily ... Lus10023101 14.1 0.8105
AT2G37560 ATORC2 origin recognition complex sec... Lus10024412 15.0 0.8153
AT3G63170 Chalcone-flavanone isomerase f... Lus10042592 15.0 0.8195
AT5G38830 Cysteinyl-tRNA synthetase, cla... Lus10010336 17.0 0.8065
AT5G16710 DHAR3 dehydroascorbate reductase 1 (... Lus10028510 18.4 0.8347

Lus10039661 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.