Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027178 [exp] 156 / 7e-50 AT2G46150 47 / 2e-06 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10027179 [exp] 95 / 1e-25 AT4G23610 52 / 3e-08 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10039662 [exp] 92 / 1e-24 AT4G23610 50 / 1e-07 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10039664 [exp] 70 / 3e-16 AT2G46150 74 / 3e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10027177 [exp] 70 / 3e-16 AT2G46150 77 / 2e-17 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031554 [exp] 68 / 2e-15 AT3G54200 64 / 1e-12 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10015120 [exp] 56 / 6e-11 AT2G46150 56 / 8e-10 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10040941 [exp] 49 / 3e-08 AT3G54200 63 / 1e-11 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039663 pacid=23165276 polypeptide=Lus10039663 locus=Lus10039663.g ID=Lus10039663.BGIv1.0 annot-version=v1.0 ATGCATTTGGTTCTAGAGCCAGAACTCACTACCAGTCTAGGTGGCTTGTCGACGGTGAACCTGACGGCGCCGGCGGTGCTGATGGCGTCGAAGATGAGGA CAGTAGCGGTGGGGGACATAGTGAAGGGACAGGCGAACTTGACTTCGAAGGCGACACTGCACGGGACAGCATCGTTGATGGGGTTGAAGCTGAAGGCGTC GGTCTGCGTCGAGTGTTACCTTACCGTTGTGTTGCTTAACCGGACGTTGGGCGGGTCGGGTTGGTGCTGGACTGAGATGAAGATGAACTGA
AA sequence Show only first row Show all	>Lus10039663 pacid=23165276 polypeptide=Lus10039663 locus=Lus10039663.g ID=Lus10039663.BGIv1.0 annot-version=v1.0 MHLVLEPELTTSLGGLSTVNLTAPAVLMASKMRTVAVGDIVKGQANLTSKATLHGTASLMGLKLKASVCVECYLTVVLLNRTLGGSGWCWTEMKMN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039663 [exp]	0	1
AT5G26330			Cupredoxin superfamily protein...		Lus10006680 [exp]	6.6	1.0000
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10006721 [exp]	6.9	1.0000
AT2G40070			unknown protein		Lus10008717 [exp]	8.8	1.0000
					Lus10010414 [exp]	11.0	1.0000
					Lus10010663 [exp]	12.0	1.0000
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10010628 [exp]	12.2	1.0000
					Lus10014229 [exp]	13.9	1.0000
AT2G39518			Uncharacterised protein family...		Lus10031304 [exp]	14.7	1.0000
AT1G34355	FHA	ATPS1	PARALLEL SPINDLE 1, forkhead-a...		Lus10028665 [exp]	15.2	1.0000
AT4G03230			S-locus lectin protein kinase ...		Lus10031602 [exp]	15.5	1.0000

Compare expression of checked genes

Lus10039663 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.