Lus10039669 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05205 144 / 6e-47 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027173 175 / 7e-59 AT1G05205 149 / 8e-49 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G093501 148 / 2e-48 AT1G05205 142 / 5e-46 unknown protein
PFAM info
Representative CDS sequence
>Lus10039669 pacid=23165376 polypeptide=Lus10039669 locus=Lus10039669.g ID=Lus10039669.BGIv1.0 annot-version=v1.0
ATGAGCGAAACGAGGCCGGTGCCGAGGAGGGAGAGCCCATGGGGGACGCCGCAGGAAGAGCACCGGCAGCCCAAGGCTCATCGATGCAATGATCGAGATG
AAGACGTTATTCAAGCTTGTTTCGAAGGAAACCCATTCAAGACGGTTCCTGGACCTTTCAAGCTCTTCTGGGAATGCATGCGCTCCAAACCAGGGGAGGA
ACCAACAGCACCCTACACCTACCTGCAGATTGATCCTCCGACAAGAGAGGCGAAACTTGATTAA
AA sequence
>Lus10039669 pacid=23165376 polypeptide=Lus10039669 locus=Lus10039669.g ID=Lus10039669.BGIv1.0 annot-version=v1.0
MSETRPVPRRESPWGTPQEEHRQPKAHRCNDRDEDVIQACFEGNPFKTVPGPFKLFWECMRSKPGEEPTAPYTYLQIDPPTREAKLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05205 unknown protein Lus10039669 0 1
AT5G53650 unknown protein Lus10008848 1.4 0.9250
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10041194 1.7 0.9302
AT3G52730 ubiquinol-cytochrome C reducta... Lus10014198 2.8 0.9179
AT3G05070 unknown protein Lus10026367 3.9 0.9061
AT5G20570 HRT1, ROC1, RBX... REGULATOR OF CULLINS-1, RING-b... Lus10015667 4.2 0.9183
AT3G07910 unknown protein Lus10039527 4.2 0.8962
AT5G07960 unknown protein Lus10021623 4.2 0.9010
AT4G34270 TIP41-like family protein (.1) Lus10026859 6.0 0.8790
AT3G17210 ATHS1 A. THALIANA HEAT STABLE PROTEI... Lus10037823 6.8 0.8674
AT1G51650 ATP synthase epsilon chain, mi... Lus10035755 7.1 0.8819

Lus10039669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.