Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G21680 49 / 3e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027167 [exp] 150 / 4e-48 AT3G10120 52 / 4e-09 unknown protein Lus10015117 [exp] 47 / 3e-07 AT5G03890 44 / 3e-06 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G229300 [exp] 53 / 2e-09 AT3G21680 42 / 2e-05 unknown protein Potri.014G153200 [exp] 44 / 2e-06 AT3G21680 45 / 8e-07 unknown protein Potri.006G213100 [exp] 40 / 8e-05 AT3G10120 122 / 9e-36 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039676 pacid=23165197 polypeptide=Lus10039676 locus=Lus10039676.g ID=Lus10039676.BGIv1.0 annot-version=v1.0 ATGGGAAATTGCATAGTGGTTCACAACGACAACCGGATCGTGTCCCTCTCGCCACAGGACGACGAGAAACTGAAGCATTTCGACGGCAAGAAGCAGAGGA ACAAGAAGAAGATGAACAAGGGTACTGTGAGGTTCAATGTTGGTGCTGGTGGTGATGATGGTAAGGAGAGATCGGACGGTGTGAGGAGGATTCGGGTTCT GGTGACGAAACAGGAGCTGCGGGAAATCCTGATGCAGCACGGAAACGAGTTGAAGTTGGAGCAGATTGTTAAGGCTGTCAAGTCCAGAAGAAGGAATGTT AAGATTGATGGTGATGATGATTGTTATGAAGAAGGTGGAGGGTGGAGGCCGACGTTAGAGAGCATACCGGAAGATCATTAG
AA sequence Show only first row Show all	>Lus10039676 pacid=23165197 polypeptide=Lus10039676 locus=Lus10039676.g ID=Lus10039676.BGIv1.0 annot-version=v1.0 MGNCIVVHNDNRIVSLSPQDDEKLKHFDGKKQRNKKKMNKGTVRFNVGAGGDDGKERSDGVRRIRVLVTKQELREILMQHGNELKLEQIVKAVKSRRRNV KIDGDDDCYEEGGGWRPTLESIPEDH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10120			unknown protein		Lus10039676 [exp]	0	1
AT4G26900		HISN4, HISHF, A...	HIS HF (.1)		Lus10043113 [exp]	5.3	0.9400
AT1G24530			Transducin/WD40 repeat-like su...		Lus10036881 [exp]	8.1	0.9383
AT2G34830	WRKY	ATWRKY35, WRKY3...	maternal effect embryo arrest ...		Lus10038426 [exp]	9.7	0.9349
AT1G28290		AGP31	arabinogalactan protein 31 (.1...		Lus10025526 [exp]	10.4	0.9363
AT3G63010		ATGID1B, GID1B	GA INSENSITIVE DWARF1B, alpha/...		Lus10008188 [exp]	11.7	0.9369
AT5G17010			Major facilitator superfamily ...		Lus10009573 [exp]	12.5	0.9275
AT1G72230			Cupredoxin superfamily protein...		Lus10025580 [exp]	14.3	0.9234
AT1G70770			Protein of unknown function DU...		Lus10001593 [exp]	15.0	0.9337
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10020673 [exp]	15.5	0.9287
AT5G22280			unknown protein		Lus10043403 [exp]	16.9	0.9092

Compare expression of checked genes

Lus10039676 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.