Lus10039683 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25140 140 / 4e-43 OLE1, OLEO1 oleosin 1 (.1)
AT2G25890 113 / 1e-32 Oleosin family protein (.1)
AT5G51210 106 / 5e-30 OLEO3 oleosin3 (.1)
AT5G40420 74 / 8e-17 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G01570 72 / 2e-16 Oleosin family protein (.1)
AT3G27660 71 / 9e-16 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT5G07550 67 / 5e-15 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3)
AT3G18570 65 / 1e-13 Oleosin family protein (.1)
AT5G61610 66 / 3e-13 Oleosin family protein (.1)
AT1G48990 56 / 2e-10 Oleosin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027161 219 / 4e-74 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10031387 181 / 1e-59 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10010943 176 / 2e-52 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10017460 155 / 3e-49 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Lus10028822 149 / 5e-47 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Lus10022141 94 / 1e-23 AT4G25140 106 / 3e-28 oleosin 1 (.1)
Lus10017992 79 / 6e-19 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
Lus10041987 74 / 9e-17 AT3G18570 129 / 2e-38 Oleosin family protein (.1)
Lus10032461 73 / 2e-16 AT3G18570 142 / 1e-43 Oleosin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G150600 137 / 4e-42 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.001G080000 135 / 9e-42 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.006G234900 102 / 1e-28 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.018G057800 96 / 7e-26 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.001G345800 79 / 5e-19 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Potri.T125308 73 / 1e-16 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.015G081901 73 / 1e-16 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.017G071800 72 / 1e-16 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
Potri.012G083400 67 / 2e-14 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.012G059400 66 / 7e-14 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10039683 pacid=23165060 polypeptide=Lus10039683 locus=Lus10039683.g ID=Lus10039683.BGIv1.0 annot-version=v1.0
ATGGATCAGACGCACCAGACATACGCCGGAACCACGCAGAACCCGAGCTATGGCGGCGGGGGCACAATGTACCAGCAGCAGCAGCCGAGGTCTTACCAGG
CGGTGAAGGCGGCCACTGCAGCCACCGCGGGTGGATCCCTCATCGTTCTGTCCGGTCTCATCCTTACGGCCACCGTCATTTCACTCATCATAGCCACCCC
TCTCCTTGTCATCTTCAGCCCTGTTCTTGTCCCGGCTCTCATCACCGTCGGGCTCTTGATCACCGGGTTTCTTGCTTCCGGTGGGTTCGGAGTCGCCGCC
GTCACCGTCTTGTCCTGGATCTATAGGTACGTGACCGGCGGGCACCCGGCGGGAGGGGATTCGCTGGACCAGGCTAGGTCGAAGCTGGCCGGAAAGGCCA
GGGAGGTGAAGGACAGGGCGTCGGAGTTCGCACAGCAGCATGTCACAGGTGGTCAACAGACCTCTTAA
AA sequence
>Lus10039683 pacid=23165060 polypeptide=Lus10039683 locus=Lus10039683.g ID=Lus10039683.BGIv1.0 annot-version=v1.0
MDQTHQTYAGTTQNPSYGGGGTMYQQQQPRSYQAVKAATAATAGGSLIVLSGLILTATVISLIIATPLLVIFSPVLVPALITVGLLITGFLASGGFGVAA
VTVLSWIYRYVTGGHPAGGDSLDQARSKLAGKAREVKDRASEFAQQHVTGGQQTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Lus10039683 0 1
AT1G48580 unknown protein Lus10009051 5.3 0.6683
AT1G14200 RING/U-box superfamily protein... Lus10005237 32.3 0.5784
AT5G27750 F-box/FBD-like domains contain... Lus10035326 33.8 0.5211
AT3G19920 unknown protein Lus10010181 39.0 0.5687
AT2G40220 AP2_ERF ATABI4, GIN6, S... SUCROSE UNCOUPLED 6, SUGAR-INS... Lus10009834 50.0 0.5643
AT4G02160 unknown protein Lus10010018 50.4 0.5532
Lus10006287 57.9 0.5494
AT5G36930 Disease resistance protein (TI... Lus10007830 71.4 0.4814
Lus10037868 79.4 0.5317
AT1G54410 dehydrin family protein (.1) Lus10020271 80.5 0.5176

Lus10039683 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.