Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15248 103 / 2e-29 CO B-box type zinc finger family protein (.1) AT3G21890 100 / 2e-28 CO B-box type zinc finger family protein (.1) AT3G21150 68 / 1e-14 CO EIP6, BBX32 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) AT4G27310 64 / 3e-13 CO B-box type zinc finger family protein (.1) AT5G54470 64 / 3e-13 CO B-box type zinc finger family protein (.1) AT2G33500 59 / 5e-11 CO COL14 B-box type zinc finger protein with CCT domain (.1.2) AT1G28050 56 / 6e-10 CO COL15 B-box type zinc finger protein with CCT domain (.1) AT4G15250 55 / 1e-09 CO COL11 B-box type zinc finger protein with CCT domain (.1) AT5G15840 54 / 2e-09 CO FG, CO CONSTANS, B-box type zinc finger protein with CCT domain (.1.2) AT5G15850 53 / 4e-09 CO COL1, ATCOL1 CONSTANS-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027151 [exp] 196 / 7e-66 AT4G15248 109 / 7e-32 B-box type zinc finger family protein (.1) Lus10015097 [exp] 129 / 2e-39 AT4G15248 94 / 5e-26 B-box type zinc finger family protein (.1) Lus10031583 [exp] 124 / 8e-38 AT3G21890 96 / 1e-26 B-box type zinc finger family protein (.1) Lus10031593 [exp] 67 / 2e-14 AT4G27310 119 / 2e-33 B-box type zinc finger family protein (.1) Lus10033751 [exp] 66 / 4e-14 AT4G27310 114 / 9e-32 B-box type zinc finger family protein (.1) Lus10034830 [exp] 66 / 1e-13 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Lus10033380 [exp] 62 / 3e-12 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Lus10018513 [exp] 60 / 1e-11 AT4G27310 117 / 3e-32 B-box type zinc finger family protein (.1) Lus10039727 [exp] 60 / 2e-11 AT5G54470 118 / 1e-32 B-box type zinc finger family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G121100 [exp] 130 / 3e-40 AT4G15248 108 / 2e-31 B-box type zinc finger family protein (.1) Potri.017G039400 [exp] 115 / 6e-34 AT4G15248 100 / 3e-28 B-box type zinc finger family protein (.1) Potri.013G150500 [exp] 66 / 4e-14 AT4G27310 114 / 1e-31 B-box type zinc finger family protein (.1) Potri.001G414700 [exp] 65 / 2e-13 AT5G54470 126 / 2e-35 B-box type zinc finger family protein (.1) Potri.004G027100 [exp] 62 / 2e-13 AT5G54470 97 / 4e-26 B-box type zinc finger family protein (.1) Potri.011G125400 [exp] 65 / 3e-13 AT5G54470 120 / 1e-32 B-box type zinc finger family protein (.1) Potri.004G026900 [exp] 59 / 5e-12 AT4G27310 109 / 2e-30 B-box type zinc finger family protein (.1) Potri.008G007000 [exp] 60 / 9e-12 AT3G21150 128 / 3e-36 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Potri.011G039700 [exp] 58 / 3e-11 AT4G27310 105 / 3e-28 B-box type zinc finger family protein (.1) Potri.004G027000 [exp] 56 / 3e-11 AT4G27310 91 / 5e-24 B-box type zinc finger family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00643 [flax] [poplar] zf-B_box B-box zinc finger
Representative CDS sequence Show only first row Show all	>Lus10039694 pacid=23165299 polypeptide=Lus10039694 locus=Lus10039694.g ID=Lus10039694.BGIv1.0 annot-version=v1.0 ATGTGCAGAGGTGTGCAAAACCAGAAGGGTTGTGATGAACATGGTACAGGGGTTGCTTCAGCAGCAAGGAACAGGGTTTCGGTAGGGTGTGAGCTGTGTG GAGAGAAGGCAACATTGTACTGCCAGGCTGACGATGCGTATCTGTGCAGGAAATGTGACAGATGGGTTCATGGTGCTAACTTCTTGGCTTTGAGGCACAT TAGGTGTTTGTTGTGTGACACTTGCCAAGGTTTCACTCAGAGGTACTTGGTTGGTGCTTCCATGGAGGTTGTGCTTCCAACCCTTGTTGGTTTGCAGCAG GATGTGATGAATAAGTGCATCAGTTCTGATGATGGTGGTGGTGAAGAAGAATCGGATTCAGGTTCGGTTAAACTGCCGTTTCTGTTTCTGTAG
AA sequence Show only first row Show all	>Lus10039694 pacid=23165299 polypeptide=Lus10039694 locus=Lus10039694.g ID=Lus10039694.BGIv1.0 annot-version=v1.0 MCRGVQNQKGCDEHGTGVASAARNRVSVGCELCGEKATLYCQADDAYLCRKCDRWVHGANFLALRHIRCLLCDTCQGFTQRYLVGASMEVVLPTLVGLQQ DVMNKCISSDDGGGEEESDSGSVKLPFLFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15248	CO		B-box type zinc finger family ...		Lus10039694 [exp]	0	1
AT2G29380		HAI3	highly ABA-induced PP2C gene 3...		Lus10003399 [exp]	1.0	0.9703
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10025818 [exp]	2.0	0.9510
AT5G60850	DOF	OBP4, AtDof5. 4	OBF binding protein 4 (.1)		Lus10007976 [exp]	2.6	0.9411
AT1G01470		LSR3, LEA14	LIGHT STRESS-REGULATED 3, LATE...		Lus10007905 [exp]	3.5	0.9461
AT1G74320			Protein kinase superfamily pro...		Lus10026145 [exp]	3.9	0.9463
AT2G38050		DWF6, DET2, ATD...	DWARF 6, DE-ETIOLATED 2, 3-oxo...		Lus10021127 [exp]	4.0	0.9208
AT1G53280		AtDJ1B	DJ-1 homolog B, Class I glutam...		Lus10020345 [exp]	4.2	0.9191
AT4G29680			Alkaline-phosphatase-like fami...		Lus10032681 [exp]	4.9	0.9352
AT5G67020			unknown protein		Lus10019344 [exp]	5.9	0.9458
AT1G17870		ATEGY3	ethylene-dependent gravitropis...		Lus10006140 [exp]	6.0	0.9308

Compare expression of checked genes

Lus10039694 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.