Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22060 74 / 6e-17 Receptor-like protein kinase-related family protein (.1) AT4G05200 64 / 8e-13 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT5G48540 55 / 9e-10 receptor-like protein kinase-related family protein (.1) AT1G61750 55 / 9e-10 Receptor-like protein kinase-related family protein (.1) AT5G41290 52 / 9e-09 Receptor-like protein kinase-related family protein (.1) AT4G21230 52 / 1e-08 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1) AT5G41300 49 / 9e-08 Receptor-like protein kinase-related family protein (.1) AT1G63560 49 / 1e-07 Receptor-like protein kinase-related family protein (.1) AT3G58310 49 / 1e-07 Domain of unknown function (DUF26) (.1) AT4G23270 48 / 4e-07 CRK19 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027145 [exp] 187 / 1e-60 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1) Lus10038227 [exp] 54 / 2e-09 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1) Lus10006752 [exp] 52 / 1e-08 AT5G48540 100 / 1e-24 receptor-like protein kinase-related family protein (.1) Lus10018377 [exp] 52 / 2e-08 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10007632 [exp] 51 / 3e-08 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10025875 [exp] 49 / 2e-07 AT5G48540 261 / 2e-87 receptor-like protein kinase-related family protein (.1) Lus10018380 [exp] 48 / 4e-07 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10015095 [exp] 42 / 4e-05 AT4G23310 220 / 4e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10018382 [exp] 42 / 5e-05 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G120700 [exp] 82 / 7e-20 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1) Potri.007G120500 [exp] 82 / 7e-20 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1) Potri.007G120400 [exp] 80 / 3e-19 AT3G22060 270 / 8e-92 Receptor-like protein kinase-related family protein (.1) Potri.007G120401 [exp] 80 / 3e-19 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1) Potri.017G039966 [exp] 79 / 1e-18 AT3G22060 273 / 5e-93 Receptor-like protein kinase-related family protein (.1) Potri.007G120501 [exp] 77 / 4e-18 AT3G22060 271 / 4e-92 Receptor-like protein kinase-related family protein (.1) Potri.017G040450 [exp] 77 / 6e-18 AT3G22060 274 / 4e-93 Receptor-like protein kinase-related family protein (.1) Potri.017G040132 [exp] 68 / 5e-15 AT3G22060 157 / 7e-48 Receptor-like protein kinase-related family protein (.1) Potri.017G040049 [exp] 63 / 1e-12 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1) Potri.004G023700 [exp] 62 / 5e-12 AT4G05200 474 / 3e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10039698 pacid=23165264 polypeptide=Lus10039698 locus=Lus10039698.g ID=Lus10039698.BGIv1.0 annot-version=v1.0 ATGGCTTCCTCCACTAGTTACAATCTCCTAATCATCACTCTTCTAGCCGCCGTCACCACCCTCGTCGCCGGCGACCAACCACTATTCCACTTCTGTTCAC CTTCCCTGCAATCCTCAAACCAAGACGTCCCTGCTTTCAACGTTAACCTCAAGACCCTCTTCTCCAAGCTCTCCAACCAAGCCCCGCCCACCGGCTTCGC CAACGTCGCCGTCGGCGGCTACCGAAGCGGCAGCCGGGTCTACGGCCTCGCCCTCTGCCGTGCTGACGTCGCCTCCGCCACCAACTGCAAATCGTGCCTC ACCGACGCCGCCAGCGAGATTTCCGGCCGCTGCCCTTCGAACAGCAGCGCAATCATTTGGTTTCTAGCCGTTCATGTTTGA
AA sequence Show only first row Show all	>Lus10039698 pacid=23165264 polypeptide=Lus10039698 locus=Lus10039698.g ID=Lus10039698.BGIv1.0 annot-version=v1.0 MASSTSYNLLIITLLAAVTTLVAGDQPLFHFCSPSLQSSNQDVPAFNVNLKTLFSKLSNQAPPTGFANVAVGGYRSGSRVYGLALCRADVASATNCKSCL TDAASEISGRCPSNSSAIIWFLAVHV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22060			Receptor-like protein kinase-r...		Lus10039698 [exp]	0	1
AT3G22060			Receptor-like protein kinase-r...		Lus10039699 [exp]	1.0	0.9618
AT4G24110			unknown protein		Lus10017328 [exp]	3.0	0.8750
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10005343 [exp]	3.5	0.8642
AT2G15780			Cupredoxin superfamily protein...		Lus10025269 [exp]	3.9	0.8507
AT4G23030			MATE efflux family protein (.1...		Lus10027417 [exp]	5.7	0.8852
AT2G43590			Chitinase family protein (.1)		Lus10035620 [exp]	9.8	0.8175
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10040475 [exp]	10.7	0.7966
AT2G47190	MYB	AtMYB2	myb domain protein 2 (.1)		Lus10038062 [exp]	13.4	0.8374
AT1G75290			NAD(P)-binding Rossmann-fold s...		Lus10032470 [exp]	13.6	0.7352
AT5G51890			Peroxidase superfamily protein...		Lus10031664 [exp]	16.7	0.8370

Compare expression of checked genes

Lus10039698 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.