Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25810 79 / 3e-18 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G25830 77 / 1e-17 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) AT3G25820 77 / 1e-17 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2) AT2G24210 75 / 4e-17 AtTPS10 terpene synthase 10 (.1) AT4G16730 72 / 7e-16 AtTPS02 terpene synthase 02 (.1) AT4G16740 67 / 5e-14 ATTPS03 terpene synthase 03 (.1.2) AT3G29410 61 / 3e-12 AtTPS25 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT1G33750 58 / 5e-11 AtTPS22 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G32030 51 / 1e-08 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT5G23960 50 / 3e-08 ATTPS21 terpene synthase 21 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039712 [exp] 218 / 1e-75 AT3G25810 78 / 4e-18 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10018500 [exp] 191 / 3e-59 AT4G16740 419 / 1e-140 terpene synthase 03 (.1.2) Lus10039713 [exp] 144 / 8e-42 AT4G16740 409 / 4e-136 terpene synthase 03 (.1.2) Lus10018501 [exp] 132 / 2e-37 AT4G16740 413 / 1e-137 terpene synthase 03 (.1.2) Lus10033643 [exp] 68 / 2e-14 AT4G16730 356 / 2e-115 terpene synthase 02 (.1) Lus10012312 [exp] 67 / 3e-14 AT4G16740 363 / 3e-118 terpene synthase 03 (.1.2) Lus10031352 [exp] 66 / 8e-14 AT3G25810 236 / 2e-73 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10006355 [exp] 66 / 1e-13 AT2G24210 361 / 7e-117 terpene synthase 10 (.1) Lus10006356 [exp] 62 / 3e-12 AT3G25820 371 / 3e-121 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G118600 [exp] 96 / 2e-24 AT4G16740 462 / 3e-157 terpene synthase 03 (.1.2) Potri.017G041700 [exp] 84 / 4e-20 AT3G25810 432 / 3e-145 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.019G023008 [exp] 73 / 2e-16 AT3G25830 535 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023006 [exp] 73 / 2e-16 AT3G25830 540 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.001G308300 [exp] 73 / 3e-16 AT3G25830 507 / 4e-174 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023020 [exp] 72 / 5e-16 AT3G25830 440 / 1e-151 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.001G308200 [exp] 69 / 9e-15 AT3G25810 499 / 4e-171 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.011G142800 [exp] 62 / 2e-12 AT5G23960 405 / 2e-135 terpene synthase 21 (.1.2) Potri.007G119700 [exp] 60 / 8e-12 AT4G16740 438 / 8e-147 terpene synthase 03 (.1.2) Potri.019G023000 [exp] 58 / 5e-11 AT4G16740 208 / 8e-63 terpene synthase 03 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0613 [flax] [poplar] Terp_synthase PF03936 [flax] [poplar] Terpene_synth_C Terpene synthase family, metal binding domain
Representative CDS sequence Show only first row Show all	>Lus10039711 pacid=23165380 polypeptide=Lus10039711 locus=Lus10039711.g ID=Lus10039711.BGIv1.0 annot-version=v1.0 ATGGCGAGAGGAGAGACGGTGAACGCGATCTCGAGCTACATGAACGAGAACGGAGTTAGTGAAGAGAAGGCAAGGAAGCACTTGAGCTCCATGATCGACC AAGCTTGGAAGAACATGAATAAGGAGCTATTAGAAGATCACGACGAGAAGTCGGTGTCTGATCAGCTCGCGAAGTCGTTTCGAAGATCGGCGATGAATCT GGCGAGGATCACTTATTATAGTTACAGGCGTGGAGACAGCCACGGGAATCCAGATGCCGAGTCCAACCAGACTGTCTTCTCCCTCTTCTTCCAGCCCATC GTTACCAAGGCTTAA
AA sequence Show only first row Show all	>Lus10039711 pacid=23165380 polypeptide=Lus10039711 locus=Lus10039711.g ID=Lus10039711.BGIv1.0 annot-version=v1.0 MARGETVNAISSYMNENGVSEEKARKHLSSMIDQAWKNMNKELLEDHDEKSVSDQLAKSFRRSAMNLARITYYSYRRGDSHGNPDAESNQTVFSLFFQPI VTKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25810			Terpenoid cyclases/Protein pre...		Lus10039711 [exp]	0	1
AT3G25810			Terpenoid cyclases/Protein pre...		Lus10039712 [exp]	1.0	0.9776
AT5G52830	WRKY	ATWRKY27, WRKY2...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10027538 [exp]	1.4	0.9314
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10016890 [exp]	2.4	0.8929
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10036296 [exp]	15.9	0.9053
AT5G35370			S-locus lectin protein kinase ...		Lus10025618 [exp]	16.6	0.8954
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10003149 [exp]	20.3	0.8982
AT1G74790			catalytics (.1)		Lus10033116 [exp]	25.2	0.8928
AT1G76690		OPR2, ATOPR2	ARABIDOPSIS 12-OXOPHYTODIENOAT...		Lus10013218 [exp]	31.2	0.8911
AT5G66170		STR18	sulfurtransferase 18 (.1.2.3)		Lus10041894 [exp]	31.5	0.8782
AT2G24260	bHLH	LRL1, bHLH066	LJRHL1-like 1 (.1)		Lus10021846 [exp]	37.3	0.8846

Compare expression of checked genes

Lus10039711 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.