Lus10039715 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03210 441 / 1e-157 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT5G13870 330 / 9e-114 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT2G06850 314 / 3e-107 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT3G23730 308 / 6e-105 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G65730 306 / 2e-104 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT4G37800 303 / 3e-103 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT4G14130 297 / 8e-101 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 291 / 2e-98 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 288 / 4e-97 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 286 / 8e-97 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018503 606 / 0 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10031586 533 / 0 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10033755 475 / 5e-170 AT4G03210 340 / 5e-117 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10011052 331 / 2e-113 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10003022 329 / 4e-113 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10040121 325 / 1e-111 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10030923 319 / 3e-109 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10039643 296 / 3e-100 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10011597 296 / 3e-100 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G125000 499 / 2e-180 AT4G03210 450 / 3e-161 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.013G152400 496 / 2e-179 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.003G159700 322 / 2e-110 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.007G008500 321 / 3e-110 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.001G071000 321 / 4e-110 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G140300 316 / 3e-108 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.013G005700 301 / 1e-101 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.011G077320 298 / 6e-101 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.006G170100 294 / 1e-99 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G169900 294 / 1e-99 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10039715 pacid=23165312 polypeptide=Lus10039715 locus=Lus10039715.g ID=Lus10039715.BGIv1.0 annot-version=v1.0
ATGGCGGTCTCAATCTCCAGAGCTTCCCTTCAGTTAGCACTTTTCGTTGGATTATCCACTCTAGCTATAGTCAGTTCAGCTCCCGCCAAGTTTGATGACC
TCTTCCAACCCAGCTGGGCTTTTGATCACTTAGTCTATGAAGGAGAACAGCTCAAGCTCAAACTTGATAACTATTCCGGATCCGGGTTTCAATCGAAGAG
CAAGTACCTATTCGGAAAGGTGACGGTTCAGATTAAGCTCGTGGAAGGCGATTCCGCCGGAACTGTTACCGCCTTCTACATGTCGTCGGAGGGACCGACT
CATAACGAGTTCGATTTCGAGTTCCTGGGTAATAAAACAGGAGAGCCGTACGTCGTCCAGACGAATGTGTTCGTCAATGGCGTCGGCAACAGAGAGCAAA
GGTTGAACCTTTGGTTCGATCCAACCAAGGATTTCCATAGCTACTCCATCTTCTGGAACCCCAGTCAAGTCATATTTCTAGTGGACGACACTCCGATAAG
GCAGCACACGAACTTGGAGCACAAGGGGATCCCATTCCCGAAAGACCAACCCATGGGAGTGTACAGCTCGATCTGGAACGCCGACGATTGGGCGACCCAG
GGGGGTTTGGTCAAGACGGATTGGAGCCACGCGCCGTTCGTCGCGTCGTATAAGGGATTTGAGATCGATGCTTGTGAAAGTCCGGCGACGGCGATGTCAG
CGGCTGATCTGACGAAGAAGTGCACCAGTAGCGGCGAGAAGAAGTACTGGTGGGATGAGCCGACTTTGAGTGGGATGAATGTTCATCAGAGTCATCAGTT
GCTTTGGGTTAAGAAGAATCATATGATTTACGATTACTGTAGTGATAACTCGAGGTTCCCTGTTACACCTGAGGAGTGTCGGCATCACCGCCATTGA
AA sequence
>Lus10039715 pacid=23165312 polypeptide=Lus10039715 locus=Lus10039715.g ID=Lus10039715.BGIv1.0 annot-version=v1.0
MAVSISRASLQLALFVGLSTLAIVSSAPAKFDDLFQPSWAFDHLVYEGEQLKLKLDNYSGSGFQSKSKYLFGKVTVQIKLVEGDSAGTVTAFYMSSEGPT
HNEFDFEFLGNKTGEPYVVQTNVFVNGVGNREQRLNLWFDPTKDFHSYSIFWNPSQVIFLVDDTPIRQHTNLEHKGIPFPKDQPMGVYSSIWNADDWATQ
GGLVKTDWSHAPFVASYKGFEIDACESPATAMSAADLTKKCTSSGEKKYWWDEPTLSGMNVHQSHQLLWVKKNHMIYDYCSDNSRFPVTPEECRHHRH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G03210 XTH9, EXGT-A6, ... xyloglucan endotransglucosylas... Lus10039715 0 1
AT4G03210 XTH9, EXGT-A6, ... xyloglucan endotransglucosylas... Lus10018503 1.0 0.8946
AT4G04720 CPK21 calcium-dependent protein kina... Lus10020046 2.8 0.8693
AT5G50870 UBC27 ubiquitin-conjugating enzyme 2... Lus10022248 4.2 0.8064
AT4G35785 RNA-binding (RRM/RBD/RNP motif... Lus10017507 5.0 0.8218
AT5G14370 CCT motif family protein (.1) Lus10014886 5.2 0.8567
AT5G12190 RNA-binding (RRM/RBD/RNP motif... Lus10026815 6.3 0.8288
AT2G16390 DMS1, CHR35, DR... DEFECTIVE IN RNA-DIRECTED DNA ... Lus10042070 7.1 0.8020
AT5G59250 Major facilitator superfamily ... Lus10040772 7.2 0.7932
AT5G66320 GATA GATA5 GATA transcription factor 5 (.... Lus10028360 8.8 0.8167
Lus10033157 15.2 0.7698

Lus10039715 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.