Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28320 86 / 8e-21 MAN5, AtMAN5 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1) AT2G20680 85 / 1e-20 MAN2, AtMAN2 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) AT5G01930 61 / 4e-12 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1) AT5G66460 44 / 2e-06 MAN7, AtMAN7 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) AT3G10900 44 / 4e-06 Glycosyl hydrolase superfamily protein (.1) AT3G10890 42 / 1e-05 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039833 [exp] 114 / 2e-31 AT2G20680 633 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10018598 [exp] 112 / 1e-30 AT2G20680 627 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10031650 [exp] 98 / 3e-25 AT2G20680 655 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10033687 [exp] 96 / 2e-24 AT2G20680 644 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10014184 [exp] 62 / 1e-12 AT5G01930 674 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1) Lus10027329 [exp] 50 / 5e-08 AT2G20680 438 / 8e-152 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10039032 [exp] 49 / 9e-08 AT2G20680 433 / 8e-150 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10030347 [exp] 48 / 2e-07 AT5G66460 422 / 2e-145 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Lus10007900 [exp] 48 / 2e-07 AT5G66460 417 / 4e-143 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G130400 [exp] 98 / 2e-25 AT2G20680 661 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Potri.016G138600 [exp] 62 / 1e-12 AT5G01930 683 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1) Potri.006G109900 [exp] 61 / 7e-12 AT5G01930 659 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1) Potri.006G009400 [exp] 47 / 4e-07 AT4G28320 430 / 2e-148 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1) Potri.005G120500 [exp] 42 / 1e-05 AT5G66460 588 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Potri.007G022000 [exp] 40 / 6e-05 AT5G66460 573 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Potri.019G070200 [exp] 40 / 0.0001 AT3G10890 302 / 3e-100 Glycosyl hydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039719 pacid=23165390 polypeptide=Lus10039719 locus=Lus10039719.g ID=Lus10039719.BGIv1.0 annot-version=v1.0 ATGCGGTCGCACATCGAAGACAGCCACAAAGAGCTAAACAAGCCGGTTCTCTTCACCGAATTCGGGCTCTACAACATCAACAAGGACTTCCAGCCGTCCC AGCGCGAACTGGCTCTACAAGACCATATACGACATCATATAAAATCCTCAAAGAGAAAGCACTCTGGTGCAGGTGCCTTGATGTGGCAGCTCTTTGTCGA CCACATGGAAGACAGCAAACGACGATTTCGGCATCGTACCGTGGGAAAGAGCCTCGACGTACAAGCTGATAACCGAGCAATCCTGCGAGTTGGCGAAATT GCGAGGCGCCGTTGA
AA sequence Show only first row Show all	>Lus10039719 pacid=23165390 polypeptide=Lus10039719 locus=Lus10039719.g ID=Lus10039719.BGIv1.0 annot-version=v1.0 MRSHIEDSHKELNKPVLFTEFGLYNINKDFQPSQRELALQDHIRHHIKSSKRKHSGAGALMWQLFVDHMEDSKRRFRHRTVGKSLDVQADNRAILRVGEI ARRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28320		MAN5, AtMAN5	endo-beta-mannase 5, Glycosyl ...		Lus10039719 [exp]	0	1
AT5G46090			Protein of unknown function (D...		Lus10015396 [exp]	2.8	0.9069
AT1G79690		ATNUDT3	nudix hydrolase homolog 3 (.1)		Lus10024090 [exp]	3.7	0.9347
					Lus10010253 [exp]	4.9	0.9103
AT2G18180			Sec14p-like phosphatidylinosit...		Lus10028332 [exp]	5.3	0.9190
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10010482 [exp]	6.0	0.9314
					Lus10027774 [exp]	6.0	0.9005
AT1G15260			unknown protein		Lus10037547 [exp]	6.5	0.9199
AT3G14310		ATPME3	pectin methylesterase 3 (.1)		Lus10001848 [exp]	11.0	0.8330
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036818 [exp]	12.0	0.9150
AT3G47570			Leucine-rich repeat protein ki...		Lus10017400 [exp]	16.7	0.8603

Compare expression of checked genes

Lus10039719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.