Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03495 43 / 4e-06 HXXXD-type acyl-transferase family protein (.1) AT3G29670 41 / 1e-05 PMAT2 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1) AT1G03940 41 / 1e-05 HXXXD-type acyl-transferase family protein (.1) AT3G29680 38 / 0.0003 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018507 [exp] 141 / 3e-41 AT1G03495 286 / 2e-90 HXXXD-type acyl-transferase family protein (.1) Lus10033754 [exp] 108 / 2e-29 AT1G03495 299 / 1e-96 HXXXD-type acyl-transferase family protein (.1) Lus10031587 [exp] 104 / 5e-28 AT1G03495 305 / 7e-99 HXXXD-type acyl-transferase family protein (.1) Lus10020714 [exp] 82 / 9e-20 AT1G03495 337 / 1e-111 HXXXD-type acyl-transferase family protein (.1) Lus10005362 [exp] 53 / 1e-09 AT3G29635 292 / 4e-94 HXXXD-type acyl-transferase family protein (.1) Lus10020514 [exp] 52 / 3e-09 AT3G29590 296 / 9e-96 HXXXD-type acyl-transferase family protein (.1) Lus10020721 [exp] 50 / 2e-08 AT5G39050 280 / 2e-89 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10035802 [exp] 49 / 4e-08 AT5G39050 276 / 2e-87 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10039746 [exp] 47 / 1e-07 AT1G03940 304 / 8e-99 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G118101 [exp] 78 / 2e-18 AT1G03940 339 / 2e-112 HXXXD-type acyl-transferase family protein (.1) Potri.019G118000 [exp] 74 / 3e-17 AT1G03940 328 / 6e-108 HXXXD-type acyl-transferase family protein (.1) Potri.009G063500 [exp] 60 / 4e-12 AT1G03940 280 / 4e-89 HXXXD-type acyl-transferase family protein (.1) Potri.004G120700 [exp] 42 / 9e-06 AT5G39050 343 / 1e-113 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.010G208100 [exp] 41 / 1e-05 AT5G39050 332 / 3e-109 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.009G019700 [exp] 39 / 7e-05 AT3G29590 304 / 1e-98 HXXXD-type acyl-transferase family protein (.1) Potri.004G109300 [exp] 39 / 0.0002 AT5G39050 365 / 3e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110700 [exp] 38 / 0.0002 AT5G39050 369 / 1e-123 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103100 [exp] 38 / 0.0002 AT5G39050 366 / 1e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110400 [exp] 38 / 0.0002 AT5G39050 363 / 2e-121 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10039720 pacid=23165288 polypeptide=Lus10039720 locus=Lus10039720.g ID=Lus10039720.BGIv1.0 annot-version=v1.0 ATGGCGAACAGTCACCAACTGAAACTCCTCCATAGTTTCCAAGTTCCCCCATCACCTCCAACTTCCACCGCCGTCCTCCCACTGGCGTGTCTCGACTACC CATGGCTATTCTGCAAGCCGATGCAGCGCCTCTTCCTGTACGATTTCCCTCACCCAACTCATCCTTTCACTCAGACCATCCTCCGGGAGCTTCAACGATC ACTCTCCGCGGCGCTTCACTACTTCTTCCCTCTTGCCTGA
AA sequence Show only first row Show all	>Lus10039720 pacid=23165288 polypeptide=Lus10039720 locus=Lus10039720.g ID=Lus10039720.BGIv1.0 annot-version=v1.0 MANSHQLKLLHSFQVPPSPPTSTAVLPLACLDYPWLFCKPMQRLFLYDFPHPTHPFTQTILRELQRSLSAALHYFFPLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10039720 [exp]	0	1
AT5G15740		RRT1	O-fucosyltransferase family pr...		Lus10004629 [exp]	3.6	0.8406
					Lus10025317 [exp]	4.0	0.8164
AT3G28480			Oxoglutarate/iron-dependent ox...		Lus10032184 [exp]	4.5	0.7520
AT5G01750			Protein of unknown function (D...		Lus10009092 [exp]	7.2	0.8205
AT3G49180		RID3	ROOT INITIATION DEFECTIVE 3, T...		Lus10015407 [exp]	9.4	0.7294
AT1G60170		EMB1220	embryo defective 1220, pre-mRN...		Lus10002830 [exp]	10.8	0.7575
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10014177 [exp]	12.6	0.7981
AT4G29250			HXXXD-type acyl-transferase fa...		Lus10028335 [exp]	14.4	0.8164
AT1G18010			Major facilitator superfamily ...		Lus10019527 [exp]	14.8	0.6642
AT5G57820			zinc ion binding (.1)		Lus10007703 [exp]	15.5	0.7938

Compare expression of checked genes

Lus10039720 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.