Lus10039726 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38200 96 / 2e-23 Class I glutamine amidotransferase-like superfamily protein (.1)
AT1G66860 81 / 2e-18 Class I glutamine amidotransferase-like superfamily protein (.1)
AT4G11530 63 / 4e-12 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1)
AT4G21390 63 / 6e-12 B120 S-locus lectin protein kinase family protein (.1)
AT4G23180 62 / 8e-12 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
AT1G61610 62 / 9e-12 S-locus lectin protein kinase family protein (.1)
AT4G11900 61 / 2e-11 S-locus lectin protein kinase family protein (.1)
AT4G23240 61 / 3e-11 CRK16 cysteine-rich RLK (RECEPTOR-like protein kinase) 16 (.1)
AT1G15040 61 / 4e-11 Class I glutamine amidotransferase-like superfamily protein (.1.2)
AT4G23230 61 / 4e-11 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028493 161 / 4e-48 AT5G38200 590 / 0.0 Class I glutamine amidotransferase-like superfamily protein (.1)
Lus10009152 155 / 1e-45 AT5G38200 593 / 0.0 Class I glutamine amidotransferase-like superfamily protein (.1)
Lus10016700 86 / 4e-20 AT5G38200 621 / 0.0 Class I glutamine amidotransferase-like superfamily protein (.1)
Lus10035996 86 / 5e-20 AT5G38200 625 / 0.0 Class I glutamine amidotransferase-like superfamily protein (.1)
Lus10018512 74 / 1e-15 AT4G03230 823 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10039725 72 / 3e-15 AT4G03230 445 / 5e-144 S-locus lectin protein kinase family protein (.1)
Lus10033752 69 / 6e-14 AT4G03230 497 / 6e-169 S-locus lectin protein kinase family protein (.1)
Lus10031591 69 / 9e-14 AT4G03230 853 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10031592 67 / 2e-13 AT4G03230 351 / 3e-107 S-locus lectin protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G118551 103 / 2e-26 AT5G38200 637 / 0.0 Class I glutamine amidotransferase-like superfamily protein (.1)
Potri.010G120600 86 / 4e-20 AT5G38200 657 / 0.0 Class I glutamine amidotransferase-like superfamily protein (.1)
Potri.013G150800 72 / 5e-15 AT4G03230 1206 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.019G119600 66 / 5e-13 AT4G03230 983 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G027600 66 / 7e-13 AT4G23280 461 / 3e-156 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1)
Potri.001G411400 66 / 8e-13 AT4G27290 770 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.001G442200 66 / 9e-13 AT3G16030 528 / 5e-176 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1)
Potri.019G119700 66 / 9e-13 AT4G03230 1025 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.019G119900 65 / 1e-12 AT4G03230 974 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G027800 65 / 1e-12 AT4G23180 516 / 9e-176 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Lus10039726 pacid=23165313 polypeptide=Lus10039726 locus=Lus10039726.g ID=Lus10039726.BGIv1.0 annot-version=v1.0
ATGGGTTCCTCTGTTTCACACCGGACGGCAACCTCCAAGTCCTCGACGGAACAACAACAACAACAAAAACCAACGATTCTTCTTACTGGTCAACAACAAC
AGCCTGTGGTGAGGTTGTTGGGATTCTGCGTTGAAGGGAGTGAAAAGATGTTGCTTTATGAATACATGCCTAACAAGAGCTTGGATTCCTTCATCTTCGC
TGGGGAGATACAGCCATCGAAAGAATCAGAGTTGAAACCTGGAGCAGAATTCCTTGAGTCAAATAGAGCGCTGAGTGTGCAGCAAGAGAAGAGGCTGAAG
CAGATGACGGTGAGGAACGCAGGTTGTTACATAGAGAAAGTGAAACGTAACGAGGAAAGGGAGAAAGTTGCGAGAAGTGTGGTGGAGAAAATGTCGGTGG
AACAGCTGTCCGAGCTTTTGTCTTTCTACCGAAAGATGTCTCATATTTGCTCCGACGTTTTGGAAACAAAGCTTCCTTATCTTGGCGTTGTCTTGAAATG
A
AA sequence
>Lus10039726 pacid=23165313 polypeptide=Lus10039726 locus=Lus10039726.g ID=Lus10039726.BGIv1.0 annot-version=v1.0
MGSSVSHRTATSKSSTEQQQQQKPTILLTGQQQQPVVRLLGFCVEGSEKMLLYEYMPNKSLDSFIFAGEIQPSKESELKPGAEFLESNRALSVQQEKRLK
QMTVRNAGCYIEKVKRNEEREKVARSVVEKMSVEQLSELLSFYRKMSHICSDVLETKLPYLGVVLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38200 Class I glutamine amidotransfe... Lus10039726 0 1
AT1G67940 ABCI17, AtSTAR1... ARABIDOPSIS THALIANA NON-INTRI... Lus10035453 5.2 0.8752
Lus10004442 8.8 0.8943
AT5G38710 Methylenetetrahydrofolate redu... Lus10003053 14.4 0.8669
Lus10029608 15.7 0.8396
AT5G41850 alpha/beta-Hydrolases superfam... Lus10003902 33.6 0.8687
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10032219 39.9 0.8721
AT1G29050 TBL38 TRICHOME BIREFRINGENCE-LIKE 38... Lus10039559 44.0 0.8702
AT1G80320 2-oxoglutarate (2OG) and Fe(II... Lus10041279 44.2 0.8388
AT4G24000 ATCSLG2 ARABIDOPSIS THALIANA CELLULOSE... Lus10032416 48.6 0.8503
Lus10026135 65.2 0.8545

Lus10039726 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.