Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10265 83 / 1e-22 Wound-responsive family protein (.1) AT4G10270 73 / 2e-18 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039760 [exp] 107 / 9e-32 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10039752 [exp] 103 / 1e-30 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1) Lus10018530 [exp] 101 / 8e-30 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10039753 [exp] 100 / 5e-29 AT4G10265 120 / 4e-37 Wound-responsive family protein (.1) Lus10018531 [exp] 95 / 4e-27 AT4G10265 119 / 1e-36 Wound-responsive family protein (.1) Lus10039755 [exp] 95 / 4e-27 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 95 / 6e-27 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10018532 [exp] 91 / 2e-25 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039754 [exp] 86 / 3e-23 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G116932 [exp] 79 / 9e-21 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 79 / 9e-21 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117632 [exp] 75 / 2e-19 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 74 / 5e-19 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 74 / 5e-19 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G116500 [exp] 74 / 5e-19 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G116866 [exp] 74 / 5e-19 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117201 [exp] 74 / 7e-19 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117301 [exp] 73 / 1e-18 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1) Potri.019G117700 [exp] 72 / 4e-18 AT4G10265 89 / 5e-25 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10039751 pacid=23165366 polypeptide=Lus10039751 locus=Lus10039751.g ID=Lus10039751.BGIv1.0 annot-version=v1.0 ATGAGTTCAACTAGCAAAGCTTGGACTGCAGCAGCTAGCATCGGAGCTGTCGAGGCATTGAAAGATCAATTGGGTTTCTGTAGATGGAACCACGTCATCA AATCCGCCCAAAATTACGCGAGGAATAACGTCAGATCGGTATCTCAGGCTTCCTCAAAGCTTCCGTCGAATTCCCCTGTTTCTGCTAGATTGAAGGAATC GGAGAAGGCTCAACAGTCAGAAGAATCGTTGAGGAAAGTCATGTACTTGAACTGTTGGGGTCCTTACTAG
AA sequence Show only first row Show all	>Lus10039751 pacid=23165366 polypeptide=Lus10039751 locus=Lus10039751.g ID=Lus10039751.BGIv1.0 annot-version=v1.0 MSSTSKAWTAAASIGAVEALKDQLGFCRWNHVIKSAQNYARNNVRSVSQASSKLPSNSPVSARLKESEKAQQSEESLRKVMYLNCWGPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10265			Wound-responsive family protei...		Lus10039751 [exp]	0	1
AT4G10265			Wound-responsive family protei...		Lus10039755 [exp]	1.0	0.9885
AT4G10265			Wound-responsive family protei...		Lus10018533 [exp]	2.4	0.9817
AT4G10270			Wound-responsive family protei...		Lus10018530 [exp]	3.5	0.9816
AT2G26040		RCAR14, PYL2	regulatory components of ABA r...		Lus10037393 [exp]	4.1	0.9466
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Lus10028627 [exp]	4.8	0.9434
AT5G39890			Protein of unknown function (D...		Lus10003861 [exp]	5.3	0.9802
AT4G10265			Wound-responsive family protei...		Lus10018531 [exp]	6.3	0.9580
AT4G24110			unknown protein		Lus10001676 [exp]	6.7	0.9655
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Lus10018926 [exp]	8.4	0.9637
AT3G10040	Trihelix		sequence-specific DNA binding ...		Lus10008643 [exp]	8.8	0.9539

Compare expression of checked genes

Lus10039751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.