Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10270 107 / 7e-32 Wound-responsive family protein (.1) AT4G10265 105 / 2e-31 Wound-responsive family protein (.1) AT4G33560 47 / 3e-08 Wound-responsive family protein (.1) AT2G14070 40 / 4e-05 wound-responsive protein-related (.1) AT4G05070 39 / 7e-05 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039760 [exp] 149 / 2e-48 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10039752 [exp] 134 / 1e-42 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1) Lus10018530 [exp] 133 / 4e-42 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10018531 [exp] 129 / 9e-41 AT4G10265 119 / 1e-36 Wound-responsive family protein (.1) Lus10039751 [exp] 125 / 5e-39 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039755 [exp] 120 / 5e-37 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 116 / 1e-35 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039761 [exp] 114 / 1e-34 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039754 [exp] 114 / 1e-34 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G116866 [exp] 106 / 1e-31 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117201 [exp] 106 / 1e-31 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117500 [exp] 106 / 1e-31 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 106 / 1e-31 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117100 [exp] 105 / 2e-31 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G116932 [exp] 105 / 2e-31 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117632 [exp] 105 / 2e-31 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117200 [exp] 104 / 7e-31 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.013G148100 [exp] 104 / 9e-31 AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) Potri.013G148000 [exp] 103 / 1e-30 AT4G10270 101 / 7e-30 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10039753 pacid=23165181 polypeptide=Lus10039753 locus=Lus10039753.g ID=Lus10039753.BGIv1.0 annot-version=v1.0 ATGAGTTCAACCAGCAAGGCTTGGGCAGTTGCAGCAAGCATTGGAGCAGTGGAGGCACTAAAAGATCAGTTAGGGTTCTGTAGATGGAACTATGTTATCA GATCGGCTCAACAGTATGCGAGGAATAACGTTAGATCGGTGTCTCAAGCTTCGTCAAAGCTTTCTTCCAATTCCCCTGCTGCTTCTGCAGCTATGGTTTG TGATAGATTGAAGGAAGTGGAGAAGGCGAGACAGTCGGAAGAGTCGTTGAGAAAAGTCATGTACTTGAGCTGTTGGGGTCCTAATTAA
AA sequence Show only first row Show all	>Lus10039753 pacid=23165181 polypeptide=Lus10039753 locus=Lus10039753.g ID=Lus10039753.BGIv1.0 annot-version=v1.0 MSSTSKAWAVAASIGAVEALKDQLGFCRWNYVIRSAQQYARNNVRSVSQASSKLSSNSPAASAAMVCDRLKEVEKARQSEESLRKVMYLSCWGPN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10265			Wound-responsive family protei...		Lus10039753 [exp]	0	1
AT4G10265			Wound-responsive family protei...		Lus10033731 [exp]	2.8	0.9180
AT4G10270			Wound-responsive family protei...		Lus10039752 [exp]	3.0	0.9417
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028470 [exp]	5.3	0.9067
AT4G10265			Wound-responsive family protei...		Lus10018532 [exp]	8.1	0.9172
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028469 [exp]	8.4	0.8643
AT4G08980		FBW2	F-BOX WITH WD-40 2 (.1.2.3.4.5...		Lus10010351 [exp]	9.5	0.8174
AT1G74940			Protein of unknown function (D...		Lus10027642 [exp]	14.4	0.8455
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Lus10006130 [exp]	17.4	0.8508
AT3G10040	Trihelix		sequence-specific DNA binding ...		Lus10008643 [exp]	17.9	0.8945
AT4G10265			Wound-responsive family protei...		Lus10039755 [exp]	20.5	0.8993

Compare expression of checked genes

Lus10039753 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.