Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10265 113 / 2e-34 Wound-responsive family protein (.1) AT4G10270 112 / 5e-34 Wound-responsive family protein (.1) AT4G33560 50 / 2e-09 Wound-responsive family protein (.1) AT2G14070 50 / 6e-09 wound-responsive protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039761 [exp] 162 / 6e-54 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10018532 [exp] 152 / 6e-50 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10004297 [exp] 145 / 3e-47 AT4G10265 116 / 1e-35 Wound-responsive family protein (.1) Lus10039755 [exp] 139 / 7e-45 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 138 / 2e-44 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039760 [exp] 123 / 2e-38 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10039753 [exp] 121 / 1e-37 AT4G10265 120 / 4e-37 Wound-responsive family protein (.1) Lus10039751 [exp] 121 / 2e-37 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039752 [exp] 118 / 3e-36 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G117201 [exp] 111 / 1e-33 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G116866 [exp] 110 / 2e-33 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G116932 [exp] 109 / 7e-33 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 109 / 7e-33 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117632 [exp] 108 / 1e-32 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117301 [exp] 108 / 1e-32 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1) Potri.019G117200 [exp] 108 / 2e-32 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.019G117402 [exp] 108 / 2e-32 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 108 / 2e-32 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G116500 [exp] 103 / 9e-31 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10039754 pacid=23165096 polypeptide=Lus10039754 locus=Lus10039754.g ID=Lus10039754.BGIv1.0 annot-version=v1.0 ATGAGTTCAACAAGCAAAGCATGGATGGTGGCAGCAAGTATAGGAGCAGTGGAAGCGCTCAAGGACCAACTTGGTTTCTGCAGATGGAATTACATCCTCA GATCTGCTAATCAGTATGCTAGAAGTAATGTCAGATCCATCTCTTCACAGGCTAAGAAGAACATTGCTCCTTCTTCCTCTGCTGCGGTGGTTTCGAGTAG ATTGAAGGAGGCTCAGCAATCTGAAGAGTCGTTGAGGAAAGTTATGTACTTGAGCTGTTGGGGTCCTTACTGA
AA sequence Show only first row Show all	>Lus10039754 pacid=23165096 polypeptide=Lus10039754 locus=Lus10039754.g ID=Lus10039754.BGIv1.0 annot-version=v1.0 MSSTSKAWMVAASIGAVEALKDQLGFCRWNYILRSANQYARSNVRSISSQAKKNIAPSSSAAVVSSRLKEAQQSEESLRKVMYLSCWGPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10265			Wound-responsive family protei...		Lus10039754 [exp]	0	1
AT4G10265			Wound-responsive family protei...		Lus10039761 [exp]	1.0	0.9627
AT3G23150		ETR2	ethylene response 2, Signal tr...		Lus10021212 [exp]	2.0	0.8697
AT5G54960		PDC2	pyruvate decarboxylase-2 (.1)		Lus10002217 [exp]	5.7	0.8486
AT2G27080			Late embryogenesis abundant (L...		Lus10026762 [exp]	6.2	0.8583
AT5G12470			Protein of unknown function (D...		Lus10009956 [exp]	6.5	0.8443
AT2G03350			Protein of unknown function, D...		Lus10026639 [exp]	7.4	0.8458
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028469 [exp]	12.0	0.8151
AT5G09620			Octicosapeptide/Phox/Bem1p fam...		Lus10010753 [exp]	16.7	0.8100
AT3G53390			Transducin/WD40 repeat-like su...		Lus10026500 [exp]	18.8	0.7841
AT4G33355			Bifunctional inhibitor/lipid-t...		Lus10023087 [exp]	19.5	0.7849

Compare expression of checked genes

Lus10039754 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.