Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10265 112 / 3e-34 Wound-responsive family protein (.1) AT4G10270 111 / 9e-34 Wound-responsive family protein (.1) AT4G33560 53 / 2e-10 Wound-responsive family protein (.1) AT2G14070 36 / 0.0009 wound-responsive protein-related (.1) AT4G05070 35 / 0.0009 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018533 [exp] 140 / 6e-45 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10004297 [exp] 130 / 3e-41 AT4G10265 116 / 1e-35 Wound-responsive family protein (.1) Lus10018532 [exp] 129 / 7e-41 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039761 [exp] 127 / 6e-40 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039754 [exp] 127 / 6e-40 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039751 [exp] 127 / 8e-40 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039760 [exp] 124 / 2e-38 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10018530 [exp] 123 / 2e-38 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10039752 [exp] 122 / 3e-38 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G117632 [exp] 113 / 2e-34 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 113 / 2e-34 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 113 / 2e-34 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117201 [exp] 110 / 2e-33 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G116866 [exp] 110 / 3e-33 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117301 [exp] 108 / 1e-32 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1) Potri.019G116500 [exp] 108 / 2e-32 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G117200 [exp] 107 / 3e-32 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.019G116932 [exp] 107 / 3e-32 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 107 / 3e-32 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10039755 pacid=23165233 polypeptide=Lus10039755 locus=Lus10039755.g ID=Lus10039755.BGIv1.0 annot-version=v1.0 ATGAGTTCGACGAGCAAAGCATGGACGGTGGCGGCGAGTATCGGAGCGGTGGAGGCTTTGAAGGACCAATTGGGTTTCTGCAGATGGAATTACATCATCA GATCTGCTCATCACTATGCTAAGAACAATGTCAGATCGATCTCTCAGGCGAAGAATAGCCTTGCACCGTCATCTGCCGCGGTTGTTTCCAGTAAATTGAA GGAGGCGCAACAATCTGAAGAGTCGTTGAGGAAAGTTATGTACTTGAGTTGTTGGGGACCTTACTAG
AA sequence Show only first row Show all	>Lus10039755 pacid=23165233 polypeptide=Lus10039755 locus=Lus10039755.g ID=Lus10039755.BGIv1.0 annot-version=v1.0 MSSTSKAWTVAASIGAVEALKDQLGFCRWNYIIRSAHHYAKNNVRSISQAKNSLAPSSAAVVSSKLKEAQQSEESLRKVMYLSCWGPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10265			Wound-responsive family protei...		Lus10039755 [exp]	0	1
AT4G10265			Wound-responsive family protei...		Lus10039751 [exp]	1.0	0.9885
AT4G10265			Wound-responsive family protei...		Lus10018533 [exp]	2.8	0.9803
AT1G74940			Protein of unknown function (D...		Lus10011923 [exp]	3.5	0.9535
AT4G10270			Wound-responsive family protei...		Lus10018530 [exp]	3.9	0.9799
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Lus10028627 [exp]	5.8	0.9375
AT4G24110			unknown protein		Lus10001676 [exp]	7.1	0.9640
AT4G10270			Wound-responsive family protei...		Lus10039752 [exp]	8.8	0.9460
AT4G10265			Wound-responsive family protei...		Lus10018531 [exp]	8.8	0.9510
AT5G39890			Protein of unknown function (D...		Lus10003861 [exp]	9.2	0.9678
AT1G73160			UDP-Glycosyltransferase superf...		Lus10032187 [exp]	9.9	0.9476

Compare expression of checked genes

Lus10039755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.